100006398


Danio rerio (NCBI)
regulationactivationmapkactivitycircadianrhythmcellproliferationresponselightstimulussleepangiogenesisextracellularregiong-proteincoupledreceptorbinding

Features
Gene ID: 100006398
  
Biological name :
  
Synonyms : prok2 / prokineticin 2
  
Possible biological names infered from orthology :
  
Species: Danio rerio (NCBI)
  
Chr. number:
Strand:
Band:
Gene start:
Gene end:
  
Corresponding Affymetrix probe sets:
  
Cross references: RefSeq - 288872208
RefSeq - NC_007117.7
RefSeq - NP_001165870.1
RefSeq - NM_001172399.1
  
See co-cited genes in PubMed
Warning: Please see the Ensembl gene model ENSDARG00000091616 to get all the annotations available for this gene.


Gene Ontology (GO)
nitrogen compound metabolic processcell communicationcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcellular response to stimuluscircadian rhythmresponse to abiotic stimulussleepanatomical structure developmentnitrogen compound metabolic processcell communicationcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcellular response to stimuluscircadian rhythmresponse to abiotic stimulussleepanatomical structure developmentnitrogen compound metabolic processcell communicationcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcellular response to stimuluscircadian rhythmresponse to abiotic stimulussleepanatomical structure developmentnitrogen compound metabolic processcell communicationcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcellular response to stimuluscircadian rhythmresponse to abiotic stimulussleepanatomical structure developmentnitrogen compound metabolic processcell communicationcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcellular response to stimuluscircadian rhythmresponse to abiotic stimulussleepanatomical structure developmentnitrogen compound metabolic processcell communicationcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcellular response to stimuluscircadian rhythmresponse to abiotic stimulussleepanatomical structure developmentnitrogen compound metabolic processcell communicationcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcellular response to stimuluscircadian rhythmresponse to abiotic stimulussleepanatomical structure developmentnitrogen compound metabolic processcell communicationcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcellular response to stimuluscircadian rhythmresponse to abiotic stimulussleepanatomical structure developmentnitrogen compound metabolic processcell communicationcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcellular response to stimuluscircadian rhythmresponse to abiotic stimulussleepanatomical structure developmentnitrogen compound metabolic processcell communicationcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcellular response to stimuluscircadian rhythmresponse to abiotic stimulussleepanatomical structure developmentnitrogen comnitrogen compound metabolic processcell communicell communicationcellular metcellular metabolic processprimary metaprimary metabolic processregulation oregulation of molecular functionorganic subsorganic substance metabolic processcellular rescellular response to stimuluscircadian rhcircadian rhythmresponse to response to abiotic stimulussleepsleepanatomical sanatomical structure development
protein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein binding
extracellular regionextracellular regionextracellular regionextracellular regionextracellular regionextracellular regionextracellular regionextracellular regionextracellular regionextracellular regionextracellular regionextracellular region
TypeGO IDTermEv.Code
 biological_processGO:0000187 activation of MAPK activity IBA
 biological_processGO:0007623 circadian rhythm IBA
 biological_processGO:0008284 positive regulation of cell proliferation IBA
 biological_processGO:0009416 response to light stimulus IMP
 biological_processGO:0030431 sleep IMP
 biological_processGO:0045765 regulation of angiogenesis IBA
 cellular_componentGO:0005576 extracellular region IBA
 molecular_functionGO:0001664 G-protein coupled receptor binding IBA


Pathways (from Reactome)
Pathway description
No match


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr