114255


Mus musculus (NCBI)
proteintransmembranereceptortyrosinekinasesignalingpathwaynervousdevelopmentregulationmapkcascadebinding

Features
Gene ID: 114255
  
Biological name :
  
Synonyms : docking protein 4 / Dok4
  
Possible biological names infered from orthology :
  
Species: Mus musculus (NCBI)
  
Chr. number:
Strand:
Band:
Gene start:
Gene end:
  
Corresponding Affymetrix probe sets: 1423376_a_at (Mouse Genome 430 2.0 Array)   
  
Cross references: RefSeq - 568955943
RefSeq - XP_006530642.1
RefSeq - NC_000074.6
RefSeq - 16716573
RefSeq - NP_444476.1
RefSeq - NM_053246.3
RefSeq - XM_006530579.3
  
See co-cited genes in PubMed
Warning: Please see the Ensembl gene model ENSMUSG00000040631 to get all the annotations available for this gene.


Gene Ontology (GO)
cell communicationcellular response to stimulusanatomical structure developmentnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcell communicationcellular response to stimulusanatomical structure developmentnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcell communicationcellular response to stimulusanatomical structure developmentnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcell communicationcellular response to stimulusanatomical structure developmentnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcell communicationcellular response to stimulusanatomical structure developmentnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcell communicationcellular response to stimulusanatomical structure developmentnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcell communicationcellular response to stimulusanatomical structure developmentnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcell communicationcellular response to stimulusanatomical structure developmentnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcell communicationcellular response to stimulusanatomical structure developmentnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcell communicationcellular response to stimulusanatomical structure developmentnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcell communicationcell communicationcellular response tocellular response to stimulusanatomical structureanatomical structure developmentnitrogen compound menitrogen compound metabolic processcellular metabolic pcellular metabolic processprimary metabolic prprimary metabolic processorganic substance meorganic substance metabolic process
protein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein binding
TypeGO IDTermEv.Code
 biological_processGO:0007169 transmembrane receptor protein tyrosine kinase signaling pathway IPI
 biological_processGO:0007399 nervous system development IDA
 biological_processGO:0043410 positive regulation of MAPK cascade IDA
 molecular_functionGO:0005515 protein binding IPI


Pathways (from Reactome)
Pathway description
No match


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   

© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr