30211


Danio rerio (NCBI)
neuropeptidebindingreceptorsignalingextracellularhormoneactivityypathwaycell-cellfeedingbehaviorregionspaceg-proteincoupledproteintype

Features
Gene ID: 30211
  
Biological name :
  
Synonyms : peptide YYa / pyya / pyy|zgc:194161|zgc:194175
  
Possible biological names infered from orthology :
  
Species: Danio rerio (NCBI)
  
Chr. number:
Strand:
Band:
Gene start:
Gene end:
  
Corresponding Affymetrix probe sets: Dr.10338.1.S1_at (Zebrafish Array)   DrAffx.2.42.S1_s_at (Zebrafish Array)   
  
Cross references: RefSeq - NP_001157843.1
RefSeq - NP_571091.1
RefSeq - NC_007114.7
RefSeq - 18859299
RefSeq - 256418967
RefSeq - NM_001164371.1
RefSeq - NM_131016.2
  
See co-cited genes in PubMed
Warning: Please see the Ensembl gene model ENSDARG00000053449 to get all the annotations available for this gene.


Gene Ontology (GO)
cell communicationcellular response to stimulusfeeding behaviorcell communicationcellular response to stimulusfeeding behaviorcell communicationcellular response to stimulusfeeding behaviorcell communicationcellular response to stimulusfeeding behaviorcell communicationcellular response to stimulusfeeding behaviorcell communicationcellular response to stimulusfeeding behaviorcell communicationcellular response to stimulusfeeding behaviorcell communicationcellular response to stimulusfeeding behaviorcell communicationcellular response to stimulusfeeding behaviorcell communicationcellular response to stimulusfeeding behaviorcell communicationcell communicationcellular response to stimuluscellular response to stimulusfeeding behaviorfeeding behavior
protein bindingreceptor regulator activityprotein bindingreceptor regulator activityprotein bindingreceptor regulator activityprotein bindingreceptor regulator activityprotein bindingreceptor regulator activityprotein bindingreceptor regulator activityprotein bindingreceptor regulator activityprotein bindingreceptor regulator activityprotein bindingreceptor regulator activityprotein bindingreceptor regulator activityprotein bindingprotein bindingreceptor regulator activityreceptor regulator activity
extracellular regionextracellular regionextracellular regionextracellular regionextracellular regionextracellular regionextracellular regionextracellular regionextracellular regionextracellular regionextracellular regionextracellular region
TypeGO IDTermEv.Code
 biological_processGO:0007218 neuropeptide signaling pathway IEA
 biological_processGO:0007267 cell-cell signaling IBA
 biological_processGO:0007631 feeding behavior IBA
 cellular_componentGO:0005576 extracellular region IEA
 cellular_componentGO:0005615 extracellular space IBA
 molecular_functionGO:0001664 G-protein coupled receptor binding IBA
 molecular_functionGO:0005179 hormone activity IEA
 molecular_functionGO:0005184 neuropeptide hormone activity IBA
 molecular_functionGO:0005515 protein binding IPI
 molecular_functionGO:0031841 neuropeptide Y receptor binding IDA
 molecular_functionGO:0031843 type 2 neuropeptide Y receptor binding IPI


Pathways (from Reactome)
Pathway description
No match


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr