436788


Danio rerio (NCBI)
retinakinaseactivitycamera-typeeyeproteinlayerformationphosphorylationamacrinecelldifferentiationdevelopmentembryonicmorphogenesiscomplexcyclin-dependentactivatortransferase

Features
Gene ID: 436788
  
Biological name :
  
Synonyms : cdk5r1b / cdk5r1|p35|zgc:92814 / cyclin-dependent kinase 5, regulatory subunit 1b (p35)
  
Possible biological names infered from orthology :
  
Species: Danio rerio (NCBI)
  
Chr. number:
Strand:
Band:
Gene start:
Gene end:
  
Corresponding Affymetrix probe sets:
  
Cross references: RefSeq - 1051291541
RefSeq - NC_007123.7
RefSeq - NP_001002515.2
RefSeq - NM_001002515.3
  
See co-cited genes in PubMed
Warning: Please see the Ensembl gene model ENSDARG00000045087 to get all the annotations available for this gene.


Gene Ontology (GO)
anatomical structure developmentcellular metabolic processcellular developmental processanatomical structure developmentcellular metabolic processcellular developmental processanatomical structure developmentcellular metabolic processcellular developmental processanatomical structure developmentcellular metabolic processcellular developmental processanatomical structure developmentcellular metabolic processcellular developmental processanatomical structure developmentcellular metabolic processcellular developmental processanatomical structure developmentcellular metabolic processcellular developmental processanatomical structure developmentcellular metabolic processcellular developmental processanatomical structure developmentcellular metabolic processcellular developmental processanatomical structure developmentcellular metabolic processcellular developmental processanatomical structure developmentanatomical structure developmentcellular metabolic processcellular metabolic processcellular developmental processcellular developmental process
transferase activityenzyme regulator activitytransferase activityenzyme regulator activitytransferase activityenzyme regulator activitytransferase activityenzyme regulator activitytransferase activityenzyme regulator activitytransferase activityenzyme regulator activitytransferase activityenzyme regulator activitytransferase activityenzyme regulator activitytransferase activityenzyme regulator activitytransferase activityenzyme regulator activitytransferase activitytransferase activityenzyme regulator activityenzyme regulator activity
protein-containing complexprotein-containing complexprotein-containing complexprotein-containing complexprotein-containing complexprotein-containing complexprotein-containing complexprotein-containing complexprotein-containing complexprotein-containing complexprotein-containing complexprotein-containing complex
TypeGO IDTermEv.Code
 biological_processGO:0010842 retina layer formation IMP
 biological_processGO:0016310 phosphorylation IEA
 biological_processGO:0035881 amacrine cell differentiation IMP
 biological_processGO:0060041 retina development in camera-type eye IMP
 biological_processGO:0060059 embryonic retina morphogenesis in camera-type eye IMP
 cellular_componentGO:0016533 protein kinase 5 complex IEA
 molecular_functionGO:0016301 kinase activity IEA
 molecular_functionGO:0016534 cyclin-dependent protein kinase 5 activator activity IEA
 molecular_functionGO:0016740 transferase activity IEA


Pathways (from Reactome)
Pathway description
No match


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   

© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr