567411


Danio rerio (NCBI)
regulationproteinkinasecellcyclin-dependentactivitymitoticcycleserinethreoninenucleardivisionproliferationgstransitionholoenzymecomplexnucleuscytoplasmmolecularfunctionregulatorbinding

Features
Gene ID: 567411
  
Biological name :
  
Synonyms : ccndx|im:7162084 / si:ch211-152f23.5
  
Possible biological names infered from orthology :
  
Species: Danio rerio (NCBI)
  
Chr. number:
Strand:
Band:
Gene start:
Gene end:
  
Corresponding Affymetrix probe sets:
  
Cross references: RefSeq - 288872202
RefSeq - NC_007114.7
RefSeq - NP_001165869.1
RefSeq - NM_001172398.2
  
See co-cited genes in PubMed
Warning: Please see the Ensembl gene model ENSDARG00000019741 to get all the annotations available for this gene.


Gene Ontology (GO)
nitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcell cyclecellular component organizationnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcell cyclecellular component organizationnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcell cyclecellular component organizationnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcell cyclecellular component organizationnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcell cyclecellular component organizationnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcell cyclecellular component organizationnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcell cyclecellular component organizationnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcell cyclecellular component organizationnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcell cyclecellular component organizationnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processcell cyclecellular component organizationnitrogen compound menitrogen compound metabolic processcellular metabolic pcellular metabolic processprimary metabolic prprimary metabolic processregulation of molecuregulation of molecular functionorganic substance meorganic substance metabolic processcell cyclecell cyclecellular component ocellular component organization
catalytic activity, acting on a proteintransferase activityenzyme regulator activityprotein bindingcatalytic activity, acting on a proteintransferase activityenzyme regulator activityprotein bindingcatalytic activity, acting on a proteintransferase activityenzyme regulator activityprotein bindingcatalytic activity, acting on a proteintransferase activityenzyme regulator activityprotein bindingcatalytic activity, acting on a proteintransferase activityenzyme regulator activityprotein bindingcatalytic activity, acting on a proteintransferase activityenzyme regulator activityprotein bindingcatalytic activity, acting on a proteintransferase activityenzyme regulator activityprotein bindingcatalytic activity, acting on a proteintransferase activityenzyme regulator activityprotein bindingcatalytic activity, acting on a proteintransferase activityenzyme regulator activityprotein bindingcatalytic activity, acting on a proteintransferase activityenzyme regulator activityprotein bindingcatalytic activity, acting on a procatalytic activity, acting on a proteintransferase activitytransferase activityenzyme regulator activityenzyme regulator activityprotein bindingprotein binding
cellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellcellprotein-containing complexprotein-containing complexorganelleorganelle
TypeGO IDTermEv.Code
 biological_processGO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity IBA
 biological_processGO:0000278 mitotic cell cycle IBA
 biological_processGO:0007088 regulation of mitotic nuclear division IBA
 biological_processGO:0008284 positive regulation of cell proliferation IBA
 biological_processGO:0045787 positive regulation of cell cycle IBA
 biological_processGO:1900087 positive regulation of G1/S transition of mitotic cell cycle IBA
 cellular_componentGO:0000307 cyclin-dependent protein kinase holoenzyme complex IBA
 cellular_componentGO:0005634 nucleus IEA
 cellular_componentGO:0005737 cytoplasm IBA
 molecular_functionGO:0003674 molecular_function ND
 molecular_functionGO:0004672 protein kinase activity IBA
 molecular_functionGO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity IBA
 molecular_functionGO:0019901 protein kinase binding IBA


Pathways (from Reactome)
Pathway description
No match


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr