ENSDARG00000075459


Danio rerio
domainptpn20proteinfermphosphatasesuperfamilydephosphorylationtyrosinepdzprotein-tyrosineph-likeactivityptptypespecificphosphatasescatalyticacyl-coa-bindingn-terminalc-terminalcentralbandphosphatase-likeubiquitin-likedomain-containingpeptidyl-tyrosinebicellulartightjunctionassemblycytoskeleton

Features
Gene ID: ENSDARG00000075459
  
Biological name :ptpn20
  
Synonyms : protein tyrosine phosphatase, non-receptor type 20 / ptpn20
  
Possible biological names infered from orthology :
  
Species: Danio rerio
  
Chr. number: 13
Strand: 1
Band:
Gene start: 31177934
Gene end: 31228552
  
Corresponding Affymetrix probe sets:
  
Cross references: Ensembl peptide - ENSDARP00000123259
Ensembl peptide - ENSDARP00000098280
Ensembl peptide - ENSDARP00000117232
Ensembl peptide - ENSDARP00000118082
Ensembl peptide - ENSDARP00000120274
Ensembl peptide - ENSDARP00000121422
Ensembl peptide - ENSDARP00000122344
swissprot - B8JK77
swissprot - F1QBZ1
swissprot - F1QIX3
swissprot - F1QJW6
swissprot - F1QPK5
swissprot - F1QTY7
swissprot - F1R4J6
ZFIN ID - ZDB-GENE-090313-90
Ensembl - ENSDARG00000075459
  
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 ENSGALG00000044553Gallus gallus


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
ptpn21 / protein tyrosine phosphatase, non-receptor type 21 / Q16825*ENSDARG0000006224816
frmpd2 / FERM and PDZ domain containing 2 / Q68DX3*ENSDARG0000007411912
frmd6 / FERM domain containing 6 / Q8C0V9* / Q96NE9* / FERM domain-containing protein 6 *ENSDARG000000023326
ptpn13 / protein tyrosine phosphatase, non-receptor type 13 / Q12923*ENSDARG000001036996
zgc:172136 / FRMD1* / Q8N878* / FERM domain containing 1*ENSDARG000000787415
si:ch73-205h11.1 / FRMD1* / Q8N878* / FERM domain containing 1*ENSDARG000000967572
CR931802.3ENSDARG000001062451


Protein motifs (from Interpro)
Interpro ID Name
 IPR000242  PTP type protein phosphatase
 IPR000299  FERM domain
 IPR000387  Tyrosine specific protein phosphatases domain
 IPR001478  PDZ domain
 IPR003595  Protein-tyrosine phosphatase, catalytic
 IPR011993  PH-like domain superfamily
 IPR014352  FERM/acyl-CoA-binding protein superfamily
 IPR018979  FERM, N-terminal
 IPR018980  FERM, C-terminal PH-like domain
 IPR019748  FERM central domain
 IPR019749  Band 4.1 domain
 IPR029021  Protein-tyrosine phosphatase-like
 IPR029071  Ubiquitin-like domain superfamily
 IPR029906  FERM and PDZ domain-containing protein 2


Gene Ontology (GO)
nitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcellular component organizationcellular component biogenesisnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcellular component organizationcellular component biogenesisnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcellular component organizationcellular component biogenesisnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcellular component organizationcellular component biogenesisnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcellular component organizationcellular component biogenesisnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcellular component organizationcellular component biogenesisnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcellular component organizationcellular component biogenesisnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcellular component organizationcellular component biogenesisnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcellular component organizationcellular component biogenesisnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processcellular component organizationcellular component biogenesisnitrogen compound metabnitrogen compound metabolic processcellular metabolic proccellular metabolic processprimary metabolic proceprimary metabolic processorganic substance metaborganic substance metabolic processcellular component orgacellular component organizationcellular component biogcellular component biogenesis
catalytic activity, acting on a proteinhydrolase activitycatalytic activity, acting on a proteinhydrolase activitycatalytic activity, acting on a proteinhydrolase activitycatalytic activity, acting on a proteinhydrolase activitycatalytic activity, acting on a proteinhydrolase activitycatalytic activity, acting on a proteinhydrolase activitycatalytic activity, acting on a proteinhydrolase activitycatalytic activity, acting on a proteinhydrolase activitycatalytic activity, acting on a proteinhydrolase activitycatalytic activity, acting on a proteinhydrolase activitycatalytic activity, acting on a proteincatalytic activity, acting on a proteinhydrolase activityhydrolase activity
cellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellcellorganelleorganelle
TypeGO IDTermEv.Code
 biological_processGO:0006470 protein dephosphorylation IEA
 biological_processGO:0016311 dephosphorylation IEA
 biological_processGO:0035335 peptidyl-tyrosine dephosphorylation IEA
 biological_processGO:0070830 bicellular tight junction assembly IEA
 cellular_componentGO:0005856 cytoskeleton IEA
 molecular_functionGO:0004725 protein tyrosine phosphatase activity IEA
 molecular_functionGO:0016791 phosphatase activity IEA


Pathways (from Reactome)
Pathway description
No match


Phenotype (from MGI, Zfin or HPO)
IDPhenotypeDefinition Genetic BG
No match
  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   

© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr