ENSG00000102145


Homo sapiens
bindingGATA1regulationtranscriptiondnadifferentiationrnapolymeraseiisequence-specificabnormalitycellplateletactivityfactordevelopmenterythrocytemegakaryocytetranscriptionalpromoterskinanemiazincfingerregulatoryregiondna-templatedcellscomplexproximalinvolved

Features
Gene ID: ENSG00000102145
  
Biological name :GATA1
  
Synonyms : GATA1 / GATA binding protein 1 / P15976
  
Possible biological names infered from orthology :
  
Species: Homo sapiens
  
Chr. number: X
Strand: 1
Band: p11.23
Gene start: 48786554
Gene end: 48794311
  
Corresponding Affymetrix probe sets: 1555590_a_at (Human Genome U133 Plus 2.0 Array)   210446_at (Human Genome U133 Plus 2.0 Array)   
  
Cross references: Ensembl peptide - ENSP00000365858
Ensembl peptide - ENSP00000365853
NCBI entrez gene - 2623     See in Manteia.
OMIM - 305371
RefSeq - XM_011543898
RefSeq - NM_002049
RefSeq - XM_011543897
RefSeq Peptide - NP_002040
swissprot - P15976
swissprot - B7WNQ9
Ensembl - ENSG00000102145
  
Related genetic diseases (OMIM): 190685 - Leukemia, megakaryoblastic, with or without Down syndrome, somatic, 190685
  300367 - Thrombocytopenia, X-linked, with or without dyserythropoietic anemia, 300367
  300835 - Anemia, X-linked, with/without neutropenia and/or platelet abnormalities, 300835
  314050 - Thrombocytopenia with beta-thalassemia, X-linked, 314050

This gene has been taged as a transcription factor by TFT
See expression report in BioGPS
See gene description in Wikigenes
See gene description in GeneCards
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 gata1aENSDARG00000013477Danio rerio
 gata1bENSDARG00000059130Danio rerio
 Gata1ENSMUSG00000031162Mus musculus


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
GATA2 / P23769 / GATA binding protein 2ENSG0000017934838
GATA3 / P23771 / GATA binding protein 3ENSG0000010748536
GATA6 / Q92908 / GATA binding protein 6ENSG0000014144833
GATA5 / Q9BWX5 / GATA binding protein 5ENSG0000013070032
GATA4 / P43694 / GATA binding protein 4ENSG0000013657431
TRPS1 / Q9UHF7 / transcriptional repressor GATA binding 1ENSG0000010444725


Protein motifs (from Interpro)
Interpro ID Name
 IPR000679  Zinc finger, GATA-type
 IPR013088  Zinc finger, NHR/GATA-type
 IPR029524  Transcription factor GATA-1


Gene Ontology (GO)
nitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcell communicationresponse to stressregulation of biological qualitycoagulationcellular developmental processcellular component organizationossificationosteoblast proliferationcell deathcell activationcell adhesionresponse to endogenous stimulusresponse to chemicalcellular response to stimulusregulation of molecular functionnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcell communicationresponse to stressregulation of biological qualitycoagulationcellular developmental processcellular component organizationossificationosteoblast proliferationcell deathcell activationcell adhesionresponse to endogenous stimulusresponse to chemicalcellular response to stimulusregulation of molecular functionnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcell communicationresponse to stressregulation of biological qualitycoagulationcellular developmental processcellular component organizationossificationosteoblast proliferationcell deathcell activationcell adhesionresponse to endogenous stimulusresponse to chemicalcellular response to stimulusregulation of molecular functionnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcell communicationresponse to stressregulation of biological qualitycoagulationcellular developmental processcellular component organizationossificationosteoblast proliferationcell deathcell activationcell adhesionresponse to endogenous stimulusresponse to chemicalcellular response to stimulusregulation of molecular functionnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcell communicationresponse to stressregulation of biological qualitycoagulationcellular developmental processcellular component organizationossificationosteoblast proliferationcell deathcell activationcell adhesionresponse to endogenous stimulusresponse to chemicalcellular response to stimulusregulation of molecular functionnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcell communicationresponse to stressregulation of biological qualitycoagulationcellular developmental processcellular component organizationossificationosteoblast proliferationcell deathcell activationcell adhesionresponse to endogenous stimulusresponse to chemicalcellular response to stimulusregulation of molecular functionnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcell communicationresponse to stressregulation of biological qualitycoagulationcellular developmental processcellular component organizationossificationosteoblast proliferationcell deathcell activationcell adhesionresponse to endogenous stimulusresponse to chemicalcellular response to stimulusregulation of molecular functionnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcell communicationresponse to stressregulation of biological qualitycoagulationcellular developmental processcellular component organizationossificationosteoblast proliferationcell deathcell activationcell adhesionresponse to endogenous stimulusresponse to chemicalcellular response to stimulusregulation of molecular functionnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcell communicationresponse to stressregulation of biological qualitycoagulationcellular developmental processcellular component organizationossificationosteoblast proliferationcell deathcell activationcell adhesionresponse to endogenous stimulusresponse to chemicalcellular response to stimulusregulation of molecular functionnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcell communicationresponse to stressregulation of biological qualitycoagulationcellular developmental processcellular component organizationossificationosteoblast proliferationcell deathcell activationcell adhesionresponse to endogenous stimulusresponse to chemicalcellular response to stimulusregulation of molecular functionnitrognitrogen compound metabolic processbiosynbiosynthetic processcellulcellular metabolic processprimarprimary metabolic processorganiorganic substance metabolic processanatomanatomical structure developmentcell ccell communicationresponresponse to stressregularegulation of biological qualitycoagulcoagulationcellulcellular developmental processcellulcellular component organizationossifiossificationosteobosteoblast proliferationcell dcell deathcell acell activationcell acell adhesionresponresponse to endogenous stimulusresponresponse to chemicalcellulcellular response to stimulusregularegulation of molecular function
organic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingchromatin bindingion bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingchromatin bindingion bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingchromatin bindingion bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingchromatin bindingion bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingchromatin bindingion bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingchromatin bindingion bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingchromatin bindingion bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingchromatin bindingion bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingchromatin bindingion bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingchromatin bindingion bindingorganic cyclic compoundorganic cyclic compound bindingheterocyclic compound bheterocyclic compound bindingDNA-binding transcriptiDNA-binding transcription factor activityprotein bindingprotein bindingchromatin bindingchromatin bindingion bindingion binding
cellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellcellorganelleorganellemembrane-enclosed lumenmembrane-enclosed lumenprotein-containing complexprotein-containing complex
TypeGO IDTermEv.Code
 biological_processGO:0000122 negative regulation of transcription by RNA polymerase II IEA
 biological_processGO:0001701 in utero embryonic development IEA
 biological_processGO:0006351 transcription, DNA-templated IEA
 biological_processGO:0006355 regulation of transcription, DNA-templated IEA
 biological_processGO:0006366 transcription by RNA polymerase II IDA
 biological_processGO:0007267 cell-cell signaling IEA
 biological_processGO:0007596 blood coagulation TAS
 biological_processGO:0008285 negative regulation of cell proliferation IEA
 biological_processGO:0008584 male gonad development IMP
 biological_processGO:0010559 regulation of glycoprotein biosynthetic process IMP
 biological_processGO:0010724 regulation of definitive erythrocyte differentiation IDA
 biological_processGO:0010725 regulation of primitive erythrocyte differentiation IEA
 biological_processGO:0030099 myeloid cell differentiation IEA
 biological_processGO:0030218 erythrocyte differentiation IEA
 biological_processGO:0030219 megakaryocyte differentiation IEA
 biological_processGO:0030220 platelet formation IMP
 biological_processGO:0030221 basophil differentiation IEA
 biological_processGO:0030222 eosinophil differentiation IEA
 biological_processGO:0030502 negative regulation of bone mineralization IEA
 biological_processGO:0033690 positive regulation of osteoblast proliferation IEA
 biological_processGO:0035162 embryonic hemopoiesis IEA
 biological_processGO:0035854 eosinophil fate commitment IDA
 biological_processGO:0043066 negative regulation of apoptotic process IEA
 biological_processGO:0045648 positive regulation of erythrocyte differentiation IMP
 biological_processGO:0045652 regulation of megakaryocyte differentiation TAS
 biological_processGO:0045893 positive regulation of transcription, DNA-templated IEA
 biological_processGO:0045944 positive regulation of transcription by RNA polymerase II IEA
 biological_processGO:0048468 cell development IEA
 biological_processGO:0048821 erythrocyte development IEA
 biological_processGO:0048873 homeostasis of number of cells within a tissue IEA
 biological_processGO:0050731 positive regulation of peptidyl-tyrosine phosphorylation IEA
 biological_processGO:0070527 platelet aggregation IEA
 biological_processGO:0071733 transcriptional activation by promoter-enhancer looping IEA
 biological_processGO:0097028 dendritic cell differentiation IEA
 biological_processGO:0097067 cellular response to thyroid hormone stimulus IDA
 biological_processGO:1902036 regulation of hematopoietic stem cell differentiation TAS
 biological_processGO:2000678 negative regulation of transcription regulatory region DNA binding IDA
 biological_processGO:2001240 negative regulation of extrinsic apoptotic signaling pathway in absence of ligand IMP
 cellular_componentGO:0005634 nucleus IEA
 cellular_componentGO:0005654 nucleoplasm TAS
 cellular_componentGO:0005667 transcription factor complex IDA
 cellular_componentGO:0017053 transcriptional repressor complex IDA
 cellular_componentGO:0032993 protein-DNA complex IDA
 molecular_functionGO:0000976 transcription regulatory region sequence-specific DNA binding IMP
 molecular_functionGO:0000977 RNA polymerase II regulatory region sequence-specific DNA binding IDA
 molecular_functionGO:0000978 RNA polymerase II proximal promoter sequence-specific DNA binding IEA
 molecular_functionGO:0000979 RNA polymerase II core promoter sequence-specific DNA binding IMP
 molecular_functionGO:0000981 RNA polymerase II transcription factor activity, sequence-specific DNA binding IEA
 molecular_functionGO:0001047 core promoter binding IDA
 molecular_functionGO:0001077 transcriptional activator activity, RNA polymerase II proximal promoter sequence-specific DNA binding IEA
 molecular_functionGO:0001078 transcriptional repressor activity, RNA polymerase II proximal promoter sequence-specific DNA binding IDA
 molecular_functionGO:0001085 RNA polymerase II transcription factor binding IEA
 molecular_functionGO:0001158 enhancer sequence-specific DNA binding IEA
 molecular_functionGO:0001228 transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
 molecular_functionGO:0002039 p53 binding IEA
 molecular_functionGO:0003677 DNA binding IEA
 molecular_functionGO:0003682 chromatin binding IEA
 molecular_functionGO:0003700 DNA-binding transcription factor activity IEA
 molecular_functionGO:0005515 protein binding IPI
 molecular_functionGO:0008270 zinc ion binding IEA
 molecular_functionGO:0008301 DNA binding, bending IEA
 molecular_functionGO:0031490 chromatin DNA binding IDA
 molecular_functionGO:0043565 sequence-specific DNA binding IEA
 molecular_functionGO:0046872 metal ion binding IEA
 molecular_functionGO:0070742 C2H2 zinc finger domain binding IPI


Pathways (from Reactome)
Pathway description
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
RUNX1 regulates transcription of genes involved in differentiation of HSCs
Factors involved in megakaryocyte development and platelet production


Phenotype (from MGI, Zfin or HPO)
Genitourinary abnormalityAbnormality of musculatureHead and neck abnormalityAbnormality of the musculoskeletal systemAbnormality of the earsHematological abnormalityPrenatal manifestations and birth abnormalitiesAbnormality of the eyesImmunological abnormalityEndocrine abnormalityGrowth abnormalityIntegument abnormalityAbnormality of limbsAbnormality of the cardiovascular systemAbnormality of connective tissueNeurological abnormalityGonosomal inheritanceAbnormality of the digestive systemMetabolism abnormalityNeoplasiaAge of onsetSporadicPhenotypic variabilityConstitutional symptomGenitourinary abnormalityAbnormality of musculatureHead and neck abnormalityAbnormality of the musculoskeletal systemAbnormality of the earsHematological abnormalityPrenatal manifestations and birth abnormalitiesAbnormality of the eyesImmunological abnormalityEndocrine abnormalityGrowth abnormalityIntegument abnormalityAbnormality of limbsAbnormality of the cardiovascular systemAbnormality of connective tissueNeurological abnormalityGonosomal inheritanceAbnormality of the digestive systemMetabolism abnormalityNeoplasiaAge of onsetSporadicPhenotypic variabilityConstitutional symptomGenitourinary abnormalityAbnormality of musculatureHead and neck abnormalityAbnormality of the musculoskeletal systemAbnormality of the earsHematological abnormalityPrenatal manifestations and birth abnormalitiesAbnormality of the eyesImmunological abnormalityEndocrine abnormalityGrowth abnormalityIntegument abnormalityAbnormality of limbsAbnormality of the cardiovascular systemAbnormality of connective tissueNeurological abnormalityGonosomal inheritanceAbnormality of the digestive systemMetabolism abnormalityNeoplasiaAge of onsetSporadicPhenotypic variabilityConstitutional symptomGenitourinary abnormalityAbnormality of musculatureHead and neck abnormalityAbnormality of the musculoskeletal systemAbnormality of the earsHematological abnormalityPrenatal manifestations and birth abnormalitiesAbnormality of the eyesImmunological abnormalityEndocrine abnormalityGrowth abnormalityIntegument abnormalityAbnormality of limbsAbnormality of the cardiovascular systemAbnormality of connective tissueNeurological abnormalityGonosomal inheritanceAbnormality of the digestive systemMetabolism abnormalityNeoplasiaAge of onsetSporadicPhenotypic variabilityConstitutional symptomGenitourinary abnormalityAbnormality of musculatureHead and neck abnormalityAbnormality of the musculoskeletal systemAbnormality of the earsHematological abnormalityPrenatal manifestations and birth abnormalitiesAbnormality of the eyesImmunological abnormalityEndocrine abnormalityGrowth abnormalityIntegument abnormalityAbnormality of limbsAbnormality of the cardiovascular systemAbnormality of connective tissueNeurological abnormalityGonosomal inheritanceAbnormality of the digestive systemMetabolism abnormalityNeoplasiaAge of onsetSporadicPhenotypic variabilityConstitutional symptomGenitourinary abnormalityAbnormality of musculatureHead and neck abnormalityAbnormality of the musculoskeletal systemAbnormality of the earsHematological abnormalityPrenatal manifestations and birth abnormalitiesAbnormality of the eyesImmunological abnormalityEndocrine abnormalityGrowth abnormalityIntegument abnormalityAbnormality of limbsAbnormality of the cardiovascular systemAbnormality of connective tissueNeurological abnormalityGonosomal inheritanceAbnormality of the digestive systemMetabolism abnormalityNeoplasiaAge of onsetSporadicPhenotypic variabilityConstitutional symptomGenitourinary abnormalityAbnormality of musculatureHead and neck abnormalityAbnormality of the musculoskeletal systemAbnormality of the earsHematological abnormalityPrenatal manifestations and birth abnormalitiesAbnormality of the eyesImmunological abnormalityEndocrine abnormalityGrowth abnormalityIntegument abnormalityAbnormality of limbsAbnormality of the cardiovascular systemAbnormality of connective tissueNeurological abnormalityGonosomal inheritanceAbnormality of the digestive systemMetabolism abnormalityNeoplasiaAge of onsetSporadicPhenotypic variabilityConstitutional symptomGenitourinary abnormalityAbnormality of musculatureHead and neck abnormalityAbnormality of the musculoskeletal systemAbnormality of the earsHematological abnormalityPrenatal manifestations and birth abnormalitiesAbnormality of the eyesImmunological abnormalityEndocrine abnormalityGrowth abnormalityIntegument abnormalityAbnormality of limbsAbnormality of the cardiovascular systemAbnormality of connective tissueNeurological abnormalityGonosomal inheritanceAbnormality of the digestive systemMetabolism abnormalityNeoplasiaAge of onsetSporadicPhenotypic variabilityConstitutional symptomGenitourinary abnormalityAbnormality of musculatureHead and neck abnormalityAbnormality of the musculoskeletal systemAbnormality of the earsHematological abnormalityPrenatal manifestations and birth abnormalitiesAbnormality of the eyesImmunological abnormalityEndocrine abnormalityGrowth abnormalityIntegument abnormalityAbnormality of limbsAbnormality of the cardiovascular systemAbnormality of connective tissueNeurological abnormalityGonosomal inheritanceAbnormality of the digestive systemMetabolism abnormalityNeoplasiaAge of onsetSporadicPhenotypic variabilityConstitutional symptomGenitourinary abnormalityAbnormality of musculatureHead and neck abnormalityAbnormality of the musculoskeletal systemAbnormality of the earsHematological abnormalityPrenatal manifestations and birth abnormalitiesAbnormality of the eyesImmunological abnormalityEndocrine abnormalityGrowth abnormalityIntegument abnormalityAbnormality of limbsAbnormality of the cardiovascular systemAbnormality of connective tissueNeurological abnormalityGonosomal inheritanceAbnormality of the digestive systemMetabolism abnormalityNeoplasiaAge of onsetSporadicPhenotypic variabilityConstitutional symptomGenitGenitourinary abnormalityAbnorAbnormality of musculatureHead Head and neck abnormalityAbnorAbnormality of the musculoskeletal systemAbnorAbnormality of the earsHematHematological abnormalityPrenaPrenatal manifestations and birth abnormalitiesAbnorAbnormality of the eyesImmunImmunological abnormalityEndocEndocrine abnormalityGrowtGrowth abnormalityIntegIntegument abnormalityAbnorAbnormality of limbsAbnorAbnormality of the cardiovascular systemAbnorAbnormality of connective tissueNeuroNeurological abnormalityGonosGonosomal inheritanceAbnorAbnormality of the digestive systemMetabMetabolism abnormalityNeoplNeoplasiaAge oAge of onsetSporaSporadicPhenoPhenotypic variabilityConstConstitutional symptom
IDPhenotypeDefinition Genetic BG
 HP:0000028 Cryptorchidism "Absence of one or both testes from the scrotum owing to failure of the testis or testes to descend through the inguinal canal to the testis." [HPO:curators]
Show

 HP:0000078 Abnormality of the genital tract 
Show

 HP:0000079 Abnormality of the urinary tract 
Show

 HP:0000158 Macroglossia "Increased length and width of the tongue." [pmid:19125428]
Show

 HP:0000175 Cleft palate "Cleft palate is a developmental defect of the `palate` (FMA:54549) resulting from a failure of fusion of the palatine processes." [HPO:curators]
Show

 HP:0000179 Prominent lower lip "Increased thickness of the lower lip, leading to a prominent appearance of the lower lip." [HPO:curators]
Show

 HP:0000248 Brachycephaly "Brachycephaly refers to a short, wide head, which is often caused by premature closure of both coronal sutures." [HPO:curators]
Show

 HP:0000272 Malar hypoplasia "Underdeveloped midface region." [HPO:curators]
Show

 HP:0000286 Epicanthus "An epicanthal fold is a semilunar fold of skin that extends from the upper eyelid across the medial canthal area to the lower eyelid." [HPO:curators]
Show

 HP:0000405 Hearing loss, conductive 
Show

 HP:0000421 Epistaxis 
Show

 HP:0000457 Flat nose 
Show

 HP:0000474 Excess nuchal skin 
Show

 HP:0000495 Recurrent corneal erosions "The presence of recurrent corneal epithelial erosions. Although most corneal epithelial defects heal quickly, some may show recurrent ulcerations." [HPO:curators]
Show

 HP:0000498 Blepharitis "Inflammation of the eyelids." [HPO:curators]
Show

 HP:0000582 Upslanting palpebral fissures 
Show

 HP:0000656 Ectropion "An abnormal turning outward of the lower eyelid." [HPO:sdoelken]
Show

 HP:0000821 Hypothyroidism 
Show

 HP:0000823 Delayed puberty 
Show

 HP:0000938 Osteopenia "Osteopenia refers to a reduction in bone mineral density (BMD) below normal peak BMD but not low enough to be classified as osteoporosis. According to the WHO, osteopenia is characterized by a value of BMD more than 1 standard deviation below the young adult mean, but less than 2 standard deviations below this value." [HPO:curators]
Show

 HP:0000954 Transverse palmar creases "The presence of a single palmar crease (instead of the two palmar creases that are typically present)." [HPO:curators]
Show

 HP:0000967 Petechiae 
Show

 HP:0000978 Ecchymoses 
Show

 HP:0000980 Pallor 
Show

 HP:0000987 Scarring 
Show

 HP:0000992 Photosensitivity "An increased sensitivity of the skin to light. Photosensitivity may result in a rash upon exposure to the sun (which is known as photodermatosis). Photosensitivity can be diagnosed by phototests in which light is shone on small areas of skin." [HPO:curators]
Show

 HP:0000998 Hypertrichosis "Hypertrichosis is increased hair growth that is abnormal in quantity or location." [HPO:curators]
Show

 HP:0001000 Abnormality of skin pigmentation 
Show

 HP:0001007 Hirsutism "Abnormally increased hair growth." [HPO:curators]
Show

 HP:0001072 Thickened skin 
Show

 HP:0001088 Brushfield spots 
Show

 HP:0001096 Keratoconjunctivitis "Inflammation of the cornea and conjunctiva." [HPO:curators]
Show

 HP:0001155 Abnormality of the hand "An abnormality affecting one or both hands." [HPO:curators]
Show

 HP:0001169 Broad hands 
Show

 HP:0001249 Mental retardation 
Show

 HP:0001252 Muscular hypotonia "Muscular hypotonia is an abnormally low muscle tone (the amount of tension or resistance to movement in a muscle), often involving reduced muscle strength. Hypotonia is characterized by a diminished resistance to passive stretching." [HPO:curators]
Show

 HP:0001388 Joint laxity 
Show

 HP:0001419 X-linked recessive inheritance "A mode of inheritance that is observed for recessive traits related to a gene encoded on the X chromosome. In the context of medical genetics, X-linked recessive disorders manifest in males (who have one copy of the X chromosome and are thus hemizygotes), but generally not in female heterozygotes who have one mutant and one normal allele." [HPO:curators]
Show

 HP:0001581 Recurrent skin infections "Infections of the skin that happen multiple times." [HPO:curators]
Show

 HP:0001674 Complete atrioventricular canal "A congenital malformation characterized by atrial septal defect, ventricular septal defect), and abnormalities of the tricuspid and mitral valves." [HPO:curators]
Show

 HP:0001744 Splenomegaly "An abnormal enlargement of the spleen." [HPO:curators]
Show

 HP:0001760 Abnormality of the feet "An abnormality of the feet (foot deformity) is a disorder of the foot that can either be congenital or acquired. Such deformities can include hammer toe, club foot deformity, flat feet, pes cavus, Congenital vertical talus (rocker bottom foot) & etc." [HPO:curators]
Show

 HP:0001790 Nonimmune hydrops fetalis 
Show

 HP:0001873 Thrombocytopenia 
Show

 HP:0001875 Neutropenia 
Show

 HP:0001878 Hemolytic anemia 
Show

 HP:0001892 Bleeding diathesis "An abnormal susceptibility to bleeding because of a defect in coagulation." [HPO:curators]
Show

 HP:0001900 Increased hemoglobin 
Show

 HP:0001903 Anemia 
Show

 HP:0001905 Congenital thrombocytopenia 
Show

 HP:0001923 Reticulocytosis 
Show

 HP:0001927 Red cell acanthocytosis "Acanthocytosis refers to an abnormal morphiology of red-blood cells characterized by the presence of spikes on the cell surface. The cells have an irregular shaped resembling many-pointed stars." [HPO:curators]
Show

 HP:0001931 Hypochromic anemia 
Show

 HP:0001934 Persistent bleeding after trauma 
Show

 HP:0001972 Macrocytic anemia 
Show

 HP:0002023 Anal atresia "Congenital absence of the anus, i.e., the opening at the bottom end of the intestinal tract." [HPO:curators]
Show

 HP:0002076 Migraine 
Show

 HP:0002251 Congenital megacolon "An abnormality resulting from a lack of intestinal ganglion cells (i.e., an aganglionic section of bowel) that results in bowel obstruction with enlargement of the colon." [HPO:curators]
Show

 HP:0002488 Acute leukemia 
Show

 HP:0002511 Alzheimer disease 
Show

 HP:0002721 Immunodeficiency 
Show

 HP:0002757 Recurrent fractures "The repeated occurence of bone fractures (implying an abnormally increased tendency for fracture)." [HPO:curators]
Show

 HP:0002866 Hypoplastic iliac wings 
Show

 HP:0003010 Prolonged bleeding time 
Show

 HP:0003182 Shallow acetabular fossae 
Show

 HP:0003196 Nasal hypoplasia "Underdevelopment of the `nose` (FMA:46472)." [HPO:probinson]
Show

 HP:0003467 Atlantoaxial instability 
Show

 HP:0003540 Abnormal platelet aggregation 
Show

 HP:0003593 Early onset 
Show

 HP:0003745 Sporadic 
Show

 HP:0003828 Variable expressivity 
Show

 HP:0004220 Hypoplastic/small middle phalanx of the 5th finger "Absence or underdevelopment (hypoplasia) of the middle phalanx of the little (5th) finger." [HPO:curators]
Show

 HP:0004279 Hypoplastic hand 
Show

 HP:0004312 Abnormality of reticulocytes 
Show

 HP:0004322 Decreased body height "A height below that which is expected according to age and gender norms. Although there is no universally accepted definition of short stature, many refer to "short stature" as height more than 2 standard deviations below the mean for age and gender (or below the 3rd percentile for age and gender dependent norms)." [HPO:curators]
Show

 HP:0004445 Elliptocytosis 
Show

 HP:0004447 Poikilocytosis 
Show

 HP:0005547 Myeloproliferative disorder 
Show

 HP:0006733 Acute megakaryocytic leukemia 
Show

 HP:0008066 Abnormal blistering of the skin 
Show

 HP:0008551 Underdeveloped ears 
Show

 HP:0010472 Abnormality of the heme biosynthetic pathway "An abnormality in the synthesis or catabolism of heme. Heme is composed of ferrous iron and protoporphyrin IX and is an essential molecule as the prosthetic group of hemeproteins such as hemoglobin, myoglobin, mitochondrial and microsomal cytochromes." [HPO:curators]
Show

 HP:0010808 Protruding tongue "Tongue extending beyond the alveolar ridges or teeth at rest." [pmid:19125428]
Show

 HP:0010972 Anemia of inadequate production "A kind of `anemia` (HP:0001903) characterized by inadequate production of erythrocytes." [HPO:probinson]
Show

 HP:0011273 Anisocytosis "Abnormally increased variability in the size of erythrocytes." [HPO:probinson]
Show

 HP:0011675 Arrhythmia "Any cardiac rhythm other than the normal sinus rhythm. Such a rhythm may be either of sinus or ectopic origin and either regular or irregular. An arrhythmia may be due to a disturbance in impulse formation or conduction or both." [DDD:dbrown, pmid:19063792]
Show

 HP:0011869 Abnormal platelet function "Any anomaly in the function of thrombocytes." [HPO:probinson]
Show

 HP:0011875 Abnormal platelet morphology "An anomaly in platelet form, ultrastructure, or intracellular organelles." [DDD:kfreson]
Show

 HP:0011902 Abnormal hemoglobin "Anomaly in the level or the function of hemoglobin, the oxygen-carrying protein of erythrocytes." [HPO:probinson]
Show

 HP:0012086 Abnormal urinary color "An abnormal color of the urine, that is, the color of the urine appears different from the usual straw-yellow color." [HPO:probinson]
Show

 HP:0012135 Abnormality of cells of the granulocytic lineage "An anomaly of cells involved in the formation of a granulocytes, that is, of the `granulocytopoietic cell` (CL:0002191)." [DDD:akelly]
Show

 HP:0012143 Abnormality of cells of the megakaryocyte lineage "Anomaly of `megakaryocytes` (CL:0000556)." [HPO:probinson]
Show

 HP:0012145 Abnormality of multiple cell lineages in the bone marrow 
Show

 HP:0012368 Flat face "Absence of concavity or convexity of the face when viewed in profile." [pmid:19125436]
Show

 HP:0012378 Fatigue "A subjective feeling of tiredness characterized by a lack of energy and motivation." [HPO:probinson]
Show

 HP:0040185 Macrothrombocytopenia 
Show

 HP:0045040 Abnormal lactate dehydrogenase activity 
Show

 HP:0100867 Duodenal stenosis "The narrowing or partial blockage of a portion of the duodenum." [HPO:sdoelken]
Show

  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
 ENSG00000179588 ZFPM1 / Q8IX07 / zinc finger protein, FOG family member 1  / complex






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr