ENSG00000149657


Homo sapiens
domainLSM14Blsmboxsuperfamilyfdf-liken-terminalffddfdftfgregulationtranslationmulticellularorganismdevelopmentrnabinding

Features
Gene ID: ENSG00000149657
  
Biological name :LSM14B
  
Synonyms : LSM14B / LSM family member 14B / Q9BX40
  
Possible biological names infered from orthology :
  
Species: Homo sapiens
  
Chr. number: 20
Strand: 1
Band: q13.33
Gene start: 62122461
Gene end: 62135378
  
Corresponding Affymetrix probe sets: 1553304_at (Human Genome U133 Plus 2.0 Array)   219653_at (Human Genome U133 Plus 2.0 Array)   224171_at (Human Genome U133 Plus 2.0 Array)   231200_at (Human Genome U133 Plus 2.0 Array)   244488_at (Human Genome U133 Plus 2.0 Array)   
  
Cross references: Ensembl peptide - ENSP00000383172
Ensembl peptide - ENSP00000279068
Ensembl peptide - ENSP00000279069
Ensembl peptide - ENSP00000355209
Ensembl peptide - ENSP00000359953
NCBI entrez gene - 149986     See in Manteia.
RefSeq - XM_017027690
RefSeq - NM_144703
RefSeq - XM_011528612
RefSeq - XM_011528613
RefSeq - XM_011528614
RefSeq - XM_011528615
RefSeq - XM_017027688
RefSeq - XM_017027689
RefSeq - XM_005260302
RefSeq - XM_011528605
RefSeq - XM_011528606
RefSeq - XM_011528607
RefSeq - XM_011528608
RefSeq - XM_011528609
RefSeq - XM_011528611
RefSeq Peptide - NP_653304
swissprot - Q5TBP9
swissprot - Q5TBQ0
swissprot - Q5TBQ1
swissprot - Q9BX40
swissprot - A0A0C4DFV2
Ensembl - ENSG00000149657
  
See expression report in BioGPS
See gene description in Wikigenes
See gene description in GeneCards
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 lsm14bENSDARG00000025386Danio rerio
 LSM14BENSGALG00000005125Gallus gallus
 B ENSMUSG00000039108Mus musculus


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
LSM14A / Q8ND56 / LSM14A, mRNA processing body assembly factorENSG0000025710357


Protein motifs (from Interpro)
Interpro ID Name
 IPR010920  LSM domain superfamily
 IPR019050  FDF domain
 IPR025609  Lsm14-like, N-terminal
 IPR025761  FFD box
 IPR025762  DFDF domain
 IPR025768  TFG box


Gene Ontology (GO)
nitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentnitrogen compound metabnitrogen compound metabolic processbiosynthetic processbiosynthetic processcellular metabolic proccellular metabolic processprimary metabolic proceprimary metabolic processorganic substance metaborganic substance metabolic processanatomical structure deanatomical structure development
organic cyclic compound bindingheterocyclic compound bindingorganic cyclic compound bindingheterocyclic compound bindingorganic cyclic compound bindingheterocyclic compound bindingorganic cyclic compound bindingheterocyclic compound bindingorganic cyclic compound bindingheterocyclic compound bindingorganic cyclic compound bindingheterocyclic compound bindingorganic cyclic compound bindingheterocyclic compound bindingorganic cyclic compound bindingheterocyclic compound bindingorganic cyclic compound bindingheterocyclic compound bindingorganic cyclic compound bindingheterocyclic compound bindingorganic cyclic compound bindingorganic cyclic compound bindingheterocyclic compound bindingheterocyclic compound binding
TypeGO IDTermEv.Code
 biological_processGO:0006417 regulation of translation IEA
 biological_processGO:0007275 multicellular organism development IEA
 molecular_functionGO:0003723 RNA binding HDA


Pathways (from Reactome)
Pathway description
No match


Phenotype (from MGI, Zfin or HPO)
IDPhenotypeDefinition Genetic BG
No match
  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr