ENSG00000151092


Homo sapiens
domainproteindecreasedNGLY1csfsuperfamilyactivitybindinghypotoniarespiratorypainalbumintransglutaminase-likepeptidenglycanasepawgalactose-binding-likepubpub-likefoldingqualitycontrolmisfoldedincompletelysynthesizedproteinsglycoproteincatabolicprocessdeglycosylation

Features
Gene ID: ENSG00000151092
  
Biological name :NGLY1
  
Synonyms : NGLY1 / N-glycanase 1 / Q96IV0
  
Possible biological names infered from orthology :
  
Species: Homo sapiens
  
Chr. number: 3
Strand: -1
Band: p24.2
Gene start: 25718944
Gene end: 25790039
  
Corresponding Affymetrix probe sets: 207492_at (Human Genome U133 Plus 2.0 Array)   220742_s_at (Human Genome U133 Plus 2.0 Array)   
  
Cross references: Ensembl peptide - ENSP00000387430
Ensembl peptide - ENSP00000379886
Ensembl peptide - ENSP00000389888
Ensembl peptide - ENSP00000412946
Ensembl peptide - ENSP00000280699
Ensembl peptide - ENSP00000280700
Ensembl peptide - ENSP00000307980
NCBI entrez gene - 55768     See in Manteia.
OMIM - 610661
RefSeq - XM_017006839
RefSeq - NM_001145293
RefSeq - NM_001145294
RefSeq - NM_001145295
RefSeq - NM_018297
RefSeq - XM_005265316
RefSeq - XM_005265317
RefSeq - XM_011533944
RefSeq - XM_011533945
RefSeq Peptide - NP_001138767
RefSeq Peptide - NP_060767
RefSeq Peptide - NP_001138765
RefSeq Peptide - NP_001138766
swissprot - Q96IV0
swissprot - H0Y2P2
swissprot - C9JU75
swissprot - A0A0C4DFP4
Ensembl - ENSG00000151092
  
Related genetic diseases (OMIM): 615273 - Congenital disorder of deglycosylation, 615273
See expression report in BioGPS
See gene description in Wikigenes
See gene description in GeneCards
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 ngly1ENSDARG00000003205Danio rerio
 NGLY1ENSGALG00000011304Gallus gallus
 Ngly1ENSMUSG00000021785Mus musculus


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
No match


Protein motifs (from Interpro)
Interpro ID Name
 IPR002931  Transglutaminase-like
 IPR006588  Peptide N glycanase, PAW domain
 IPR008979  Galactose-binding-like domain superfamily
 IPR018997  PUB domain
 IPR036339  PUB-like domain superfamily


Gene Ontology (GO)
protein foldingnitrogen compound metabolic processcatabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processprotein foldingnitrogen compound metabolic processcatabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processprotein foldingnitrogen compound metabolic processcatabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processprotein foldingnitrogen compound metabolic processcatabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processprotein foldingnitrogen compound metabolic processcatabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processprotein foldingnitrogen compound metabolic processcatabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processprotein foldingnitrogen compound metabolic processcatabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processprotein foldingnitrogen compound metabolic processcatabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processprotein foldingnitrogen compound metabolic processcatabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processprotein foldingnitrogen compound metabolic processcatabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processprotein foldingprotein foldingnitrogen compound metabnitrogen compound metabolic processcatabolic processcatabolic processcellular metabolic proccellular metabolic processprimary metabolic proceprimary metabolic processorganic substance metaborganic substance metabolic process
hydrolase activityprotein bindingion bindinghydrolase activityprotein bindingion bindinghydrolase activityprotein bindingion bindinghydrolase activityprotein bindingion bindinghydrolase activityprotein bindingion bindinghydrolase activityprotein bindingion bindinghydrolase activityprotein bindingion bindinghydrolase activityprotein bindingion bindinghydrolase activityprotein bindingion bindinghydrolase activityprotein bindingion bindinghydrolase activityhydrolase activityprotein bindingprotein bindingion bindingion binding
cellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellcellorganelleorganelle
TypeGO IDTermEv.Code
 biological_processGO:0006457 protein folding TAS
 biological_processGO:0006515 protein quality control for misfolded or incompletely synthesized proteins IBA
 biological_processGO:0006516 glycoprotein catabolic process IDA
 biological_processGO:0006517 protein deglycosylation IGI
 cellular_componentGO:0005634 nucleus IBA
 cellular_componentGO:0005737 cytoplasm IDA
 cellular_componentGO:0005829 cytosol IBA
 molecular_functionGO:0000224 peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase activity TAS
 molecular_functionGO:0005515 protein binding IPI
 molecular_functionGO:0016787 hydrolase activity IEA
 molecular_functionGO:0046872 metal ion binding IEA


Pathways (from Reactome)
Pathway description
N-glycan trimming in the ER and Calnexin/Calreticulin cycle


Phenotype (from MGI, Zfin or HPO)
Autosomal recessive inheritanceAbnormality of the musculoskeletal systemHead and neck abnormalityNeurological abnormalityAbnormality of the eyesIntegument abnormalityAbnormality of limbsAbnormality of musculatureMetabolism abnormalityRespiratory abnormalityImmunological abnormalityAbnormality of the digestive systemConstitutional symptomAutosomal recessive inheritanceAbnormality of the musculoskeletal systemHead and neck abnormalityNeurological abnormalityAbnormality of the eyesIntegument abnormalityAbnormality of limbsAbnormality of musculatureMetabolism abnormalityRespiratory abnormalityImmunological abnormalityAbnormality of the digestive systemConstitutional symptomAutosomal recessive inheritanceAbnormality of the musculoskeletal systemHead and neck abnormalityNeurological abnormalityAbnormality of the eyesIntegument abnormalityAbnormality of limbsAbnormality of musculatureMetabolism abnormalityRespiratory abnormalityImmunological abnormalityAbnormality of the digestive systemConstitutional symptomAutosomal recessive inheritanceAbnormality of the musculoskeletal systemHead and neck abnormalityNeurological abnormalityAbnormality of the eyesIntegument abnormalityAbnormality of limbsAbnormality of musculatureMetabolism abnormalityRespiratory abnormalityImmunological abnormalityAbnormality of the digestive systemConstitutional symptomAutosomal recessive inheritanceAbnormality of the musculoskeletal systemHead and neck abnormalityNeurological abnormalityAbnormality of the eyesIntegument abnormalityAbnormality of limbsAbnormality of musculatureMetabolism abnormalityRespiratory abnormalityImmunological abnormalityAbnormality of the digestive systemConstitutional symptomAutosomal recessive inheritanceAbnormality of the musculoskeletal systemHead and neck abnormalityNeurological abnormalityAbnormality of the eyesIntegument abnormalityAbnormality of limbsAbnormality of musculatureMetabolism abnormalityRespiratory abnormalityImmunological abnormalityAbnormality of the digestive systemConstitutional symptomAutosomal recessive inheritanceAbnormality of the musculoskeletal systemHead and neck abnormalityNeurological abnormalityAbnormality of the eyesIntegument abnormalityAbnormality of limbsAbnormality of musculatureMetabolism abnormalityRespiratory abnormalityImmunological abnormalityAbnormality of the digestive systemConstitutional symptomAutosomal recessive inheritanceAbnormality of the musculoskeletal systemHead and neck abnormalityNeurological abnormalityAbnormality of the eyesIntegument abnormalityAbnormality of limbsAbnormality of musculatureMetabolism abnormalityRespiratory abnormalityImmunological abnormalityAbnormality of the digestive systemConstitutional symptomAutosomal recessive inheritanceAbnormality of the musculoskeletal systemHead and neck abnormalityNeurological abnormalityAbnormality of the eyesIntegument abnormalityAbnormality of limbsAbnormality of musculatureMetabolism abnormalityRespiratory abnormalityImmunological abnormalityAbnormality of the digestive systemConstitutional symptomAutosomal recessive inheritanceAbnormality of the musculoskeletal systemHead and neck abnormalityNeurological abnormalityAbnormality of the eyesIntegument abnormalityAbnormality of limbsAbnormality of musculatureMetabolism abnormalityRespiratory abnormalityImmunological abnormalityAbnormality of the digestive systemConstitutional symptomAutosomal Autosomal recessive inheritanceAbnormalitAbnormality of the musculoskeletal systemHead and nHead and neck abnormalityNeurologicNeurological abnormalityAbnormalitAbnormality of the eyesIntegumentIntegument abnormalityAbnormalitAbnormality of limbsAbnormalitAbnormality of musculatureMetabolismMetabolism abnormalityRespiratorRespiratory abnormalityImmunologiImmunological abnormalityAbnormalitAbnormality of the digestive systemConstitutiConstitutional symptom
IDPhenotypeDefinition Genetic BG
 HP:0000007 Autosomal recessive inheritance "A mode of inheritance that is observed for traits related to a gene encoded on one of the autosomes (i.e., the human chromosomes 1-22) in which a trait manifests in homozygotes. In the context of medical genetics, autosomal recessive disorders manifest in homozygotes (with two copies of the mutant allele) or compound heterozygotes (whereby each copy of a gene has a distinct mutant allele)." [HPO:curators]
Show

 HP:0000252 Microcephaly "Microcephaly is a neurodevelopmental disorder in which the circumference of the head is more than two standard deviations smaller than the age- and gender-dependent norm." [HPO:curators]
Show

 HP:0000316 Hypertelorism 
Show

 HP:0000486 Strabismus "Strabismus (also known as squint) is a condition in which the eyes are not properly aligned with each other." [HPO:curators]
Show

 HP:0000508 Ptosis "Drooping of the eyelid." [HPO:curators]
Show

 HP:0000522 Alacrima 
Show

 HP:0000711 Restlessness 
Show

 HP:0000939 Osteoporosis "Osteoporosis is a systemic skeletal disease characterized by low bone density and microarchitectural deterioration of bone tissue with a consequent increase in bone fragility. According to the WHO, osteoporosis is characterized by a value of BMD 2.5 standard deviations or more below the young adult mean." [HPO:curators]
Show

 HP:0000954 Transverse palmar creases "The presence of a single palmar crease (instead of the two palmar creases that are typically present)." [HPO:curators]
Show

 HP:0000970 Anhidrosis "Inability to sweat." [HPO:curators]
Show

 HP:0000975 Hyperhidrosis "An abnormally increased perspiration." [HPO:probinson]
Show

 HP:0001250 Seizures "Seizures are an intermittent `abnormality of the central nervous system` (FMA:HP:0002011) due to a sudden, excessive, disorderly discharge of cerebral neurons and characterized clinically by some combination of disturbance of sensation, loss of consciousness, impairment of psychic function, or convulsive movements." [HPO:probinson]
Show

 HP:0001252 Muscular hypotonia "Muscular hypotonia is an abnormally low muscle tone (the amount of tension or resistance to movement in a muscle), often involving reduced muscle strength. Hypotonia is characterized by a diminished resistance to passive stretching." [HPO:curators]
Show

 HP:0001263 Developmental retardation "A delay in the achievement of motor or mental milestones manifested prior to age 18 and generally associated with lifelong mental and/or physical impairments." [HPO:curators]
Show

 HP:0001265 Hyporeflexia 
Show

 HP:0001271 Polyneuropathy "A generalized disorder of peripheral nerves." [HPO:curators]
Show

 HP:0001290 Generalized hypotonia "Generalized muscular hypotonia (abnormally low muscle tone)." [HPO:curators]
Show

 HP:0001773 Short, broad feet "Abnormally short and wide feet." [HPO:curators]
Show

 HP:0001945 Fever 
Show

 HP:0002098 Respiratory distress 
Show

 HP:0002205 Recurrent respiratory infections 
Show

 HP:0002240 Hepatomegaly "An abnormal enlargment of the liver." [HPO:curators]
Show

 HP:0002487 Hyperkinesis 
Show

 HP:0002650 Scoliosis "The presence of an abnormal lateral curvature of the spine." [HPO:curators]
Show

 HP:0002910 Elevated transaminases "Elevations of the levels of SGOT and SGPT in the serum. SGOT (serum glutamic oxaloacetic transaminase) and SGPT (serum glutamic pyruvic transaminase) are transaminases primarily found in the liver and heart and are released into the bloodstream as the result of liver or heart damage. SGOT and SGPT are used clinically mainly as markers of liver damage." [HPO:curators]
Show

 HP:0003448 Decreased sensory nerve conduction velocities (NCV) 
Show

 HP:0004305 Involuntary muscle contractions 
Show

 HP:0007021 Pain insensitivity, diffuse 
Show

 HP:0007957 Variable degree of corneal opacities 
Show

 HP:0008954 Intrinsic hand muscles weakness and atrophy 
Show

 HP:0012448 Delayed myelination "`Delayed` (PATO:0000502) `myelination` (GO:0042552)." [ORCID:0000-0001-5208-3432]
Show

 HP:0012531 Pain "An unpleasant sensory and emotional experience associated with actual or potential tissue damage, or described in terms of such damage." [ORCID:0000-0001-5208-3432]
Show

 HP:0025455 Decreased CSF 5-hydroxyindolacetic acid "CSF 5-HIAA (5-hydroxyindolacetic acid) level is below the lower limit of normal." [ORCID:0000-0003-0169-8159, PMID:27388694]
Show

 HP:0025458 Decreased CSF albumin 
Show

 HP:0025460 High myoinositol in brain by MRS "An elveated level of myoinositol in the brain identified by magnetic resonance spectroscopy (MRS)." [ORCID:0000-0003-0169-8159, PMID:20951217]
Show

 HP:0030978 Decreased CSF/serum albumin ratio "A reduction below normal limits of the ratio of the cerebrospinal fluid (CSF) albumin concentration to serum albumin concentration." [ORCID:0000-0003-0169-8159, PMID:27388694]
Show

 HP:0200055 Small hands 
Show

 HP:0200136 Oral-pharyngeal dysphagia 
Show

  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr