ENSG00000166741


Homo sapiens
methyltransferaseactivityNNMTnicotinamidennmtpnmttemtresponsemethylationn-methyltransferaseconservedsites-adenosyl-l-methionine-dependentorganonitrogencompoundanimalorganregenerationnadbiosynthesisviaribosidesalvagepathwaydrugcytoplasmcytosoltransferasepyridinesalvagingmetabolism

Features
Gene ID: ENSG00000166741
  
Biological name :NNMT
  
Synonyms : nicotinamide N-methyltransferase / NNMT / P40261
  
Possible biological names infered from orthology :
  
Species: Homo sapiens
  
Chr. number: 11
Strand: 1
Band: q23.2
Gene start: 114257787
Gene end: 114313285
  
Corresponding Affymetrix probe sets: 202237_at (Human Genome U133 Plus 2.0 Array)   202238_s_at (Human Genome U133 Plus 2.0 Array)   231559_at (Human Genome U133 Plus 2.0 Array)   
  
Cross references: Ensembl peptide - ENSP00000299964
Ensembl peptide - ENSP00000441434
NCBI entrez gene - 4837     See in Manteia.
OMIM - 600008
RefSeq - NM_006169
RefSeq Peptide - NP_006160
swissprot - P40261
swissprot - Q6FH49
Ensembl - ENSG00000166741
  
Related genetic diseases (OMIM): 600008 - Homocysteine plasma level
See expression report in BioGPS
See gene description in Wikigenes
See gene description in GeneCards
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 zgc:64002ENSDARG00000086998Danio rerio
 NnmtENSMUSG00000032271Mus musculus


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
INMT / O95050 / indolethylamine N-methyltransferaseENSG0000024164452
PNMT / P11086 / phenylethanolamine N-methyltransferaseENSG0000014174437
INMT-MINDY4 / INMT-MINDY4 readthrough (NMD candidate)ENSG0000025495927


Protein motifs (from Interpro)
Interpro ID Name
 IPR000940  Methyltransferase, NNMT/PNMT/TEMT
 IPR025820  Methyltransferase NNMT/PNMT/TEMT, conserved site
 IPR029063  S-adenosyl-L-methionine-dependent methyltransferase


Gene Ontology (GO)
response to chemicalanatomical structure developmentmethylationnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processsmall molecule metabolic processorganic substance metabolic processresponse to chemicalanatomical structure developmentmethylationnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processsmall molecule metabolic processorganic substance metabolic processresponse to chemicalanatomical structure developmentmethylationnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processsmall molecule metabolic processorganic substance metabolic processresponse to chemicalanatomical structure developmentmethylationnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processsmall molecule metabolic processorganic substance metabolic processresponse to chemicalanatomical structure developmentmethylationnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processsmall molecule metabolic processorganic substance metabolic processresponse to chemicalanatomical structure developmentmethylationnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processsmall molecule metabolic processorganic substance metabolic processresponse to chemicalanatomical structure developmentmethylationnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processsmall molecule metabolic processorganic substance metabolic processresponse to chemicalanatomical structure developmentmethylationnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processsmall molecule metabolic processorganic substance metabolic processresponse to chemicalanatomical structure developmentmethylationnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processsmall molecule metabolic processorganic substance metabolic processresponse to chemicalanatomical structure developmentmethylationnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processsmall molecule metabolic processorganic substance metabolic processresponse to cheresponse to chemicalanatomical struanatomical structure developmentmethylationmethylationnitrogen compounitrogen compound metabolic processbiosynthetic prbiosynthetic processcellular metabocellular metabolic processprimary metabolprimary metabolic processsmall molecule small molecule metabolic processorganic substanorganic substance metabolic process
transferase activitytransferase activitytransferase activitytransferase activitytransferase activitytransferase activitytransferase activitytransferase activitytransferase activitytransferase activitytransferase activitytransferase activity
cellcellcellcellcellcellcellcellcellcellcellcell
TypeGO IDTermEv.Code
 biological_processGO:0010243 response to organonitrogen compound IEA
 biological_processGO:0031100 animal organ regeneration IEA
 biological_processGO:0032259 methylation TAS
 biological_processGO:0034356 NAD biosynthesis via nicotinamide riboside salvage pathway TAS
 biological_processGO:0042493 response to drug IEA
 cellular_componentGO:0005737 cytoplasm IEA
 cellular_componentGO:0005829 cytosol TAS
 molecular_functionGO:0008112 nicotinamide N-methyltransferase activity TAS
 molecular_functionGO:0008168 methyltransferase activity IEA
 molecular_functionGO:0016740 transferase activity IEA
 molecular_functionGO:0030760 pyridine N-methyltransferase activity TAS


Pathways (from Reactome)
Pathway description
Methylation
Nicotinamide salvaging
Metabolism of ingested SeMet, Sec, MeSec into H2Se


Phenotype (from MGI, Zfin or HPO)
IDPhenotypeDefinition Genetic BG
No match
  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr