ENSGALG00000000599


Gallus gallus
zincMARCH2fingerubiquitin-proteinmembraneionbindingring-ch-typeringfyvephd-typeeligasemarch-likeproteinubiquitinationendoplasmicreticulumintegralcomponentcytoplasmicvesicletransferaseactivitymetal

Features
Gene ID: ENSGALG00000000599
  
Biological name :MARCH2
  
Synonyms : MARCH2 / membrane associated ring-CH-type finger 2
  
Possible biological names infered from orthology : E3 ubiquitin-protein ligase MARCH2 / Q99M02 / Q9P0N8
  
Species: Gallus gallus
  
Chr. number: 28
Strand: -1
Band:
Gene start: 803142
Gene end: 814464
  
Corresponding Affymetrix probe sets: GgaAffx.377.1.S1_at (Chicken Array)   
  
Cross references: Ensembl peptide - ENSGALP00000000835
NCBI entrez gene - 420062     See in Manteia.
RefSeq - XM_418182
swissprot - E1C6Q0
Ensembl - ENSGALG00000000599
  
See expression report in BioGPS
See gene description in Wikigenes
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 march2ENSDARG00000061738Danio rerio
 MARCH2ENSG00000099785Homo sapiens
 March2ENSMUSG00000079557Mus musculus


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
MARCH3 / membrane associated ring-CH-type finger 3 / Q86UD3* / Q8BRX9* / E3 ubiquitin-protein ligase MARCH3 *ENSGALG0000002867362
MARCH8 / membrane associated ring-CH-type finger 8 / Q5T0T0* / Q9DBD2* / E3 ubiquitin-protein ligase MARCH8 *ENSGALG0000000586729
MARCH1 / membrane associated ring-CH-type finger 1 / Q6NZQ8* / Q8TCQ1* / E3 ubiquitin-protein ligase MARCH1 *ENSGALG0000000952026
MARCH4 / membrane associated ring-CH-type finger 4 / Q80TE3* / Q9P2E8* / E3 ubiquitin-protein ligase MARCH4 *ENSGALG0000002967519
MARCH11 / membrane associated ring-CH-type finger 11 / A6NNE9* / Q8CBH7* / E3 ubiquitin-protein ligase MARCH11 *ENSGALG0000004258417


Protein motifs (from Interpro)
Interpro ID Name
 IPR011016  Zinc finger, RING-CH-type
 IPR013083  Zinc finger, RING/FYVE/PHD-type
 IPR033275  E3 ubiquitin-protein ligase MARCH-like


Gene Ontology (GO)
nitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processnitrogen compound metabolic processcellular metabolic processcellular metabolic processprimary metabolic processprimary metabolic processorganic substance metabolic processorganic substance metabolic process
catalytic activity, acting on a proteintransferase activityion bindingcatalytic activity, acting on a proteintransferase activityion bindingcatalytic activity, acting on a proteintransferase activityion bindingcatalytic activity, acting on a proteintransferase activityion bindingcatalytic activity, acting on a proteintransferase activityion bindingcatalytic activity, acting on a proteintransferase activityion bindingcatalytic activity, acting on a proteintransferase activityion bindingcatalytic activity, acting on a proteintransferase activityion bindingcatalytic activity, acting on a proteintransferase activityion bindingcatalytic activity, acting on a proteintransferase activityion bindingcatalytic activity, acting on a proteincatalytic activity, acting on a proteintransferase activitytransferase activityion bindingion binding
cellorganellemembranecellorganellemembranecellorganellemembranecellorganellemembranecellorganellemembranecellorganellemembranecellorganellemembranecellorganellemembranecellorganellemembranecellorganellemembranecellcellorganelleorganellemembranemembrane
TypeGO IDTermEv.Code
 biological_processGO:0016567 protein ubiquitination IEA
 cellular_componentGO:0005783 endoplasmic reticulum IEA
 cellular_componentGO:0016020 membrane IEA
 cellular_componentGO:0016021 integral component of membrane IEA
 cellular_componentGO:0031410 cytoplasmic vesicle IEA
 molecular_functionGO:0004842 ubiquitin-protein transferase activity IEA
 molecular_functionGO:0008270 zinc ion binding IEA
 molecular_functionGO:0046872 metal ion binding IEA


Pathways (from Reactome)
Pathway description
No match


Phenotype (from MGI, Zfin or HPO)
IDPhenotypeDefinition Genetic BG
No match
  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

1 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr