ENSGALG00000005286


Gallus gallus
zincTRIM42fingerring-typeionbindingb-box-typefibronectintypeiiiringfyvephd-typeimmunoglobulin-likefoldconservedsiteintracellularmetal

Features
Gene ID: ENSGALG00000005286
  
Biological name :TRIM42
  
Synonyms : TRIM42 / tripartite motif containing 42
  
Possible biological names infered from orthology : Q8IWZ5 / Q9D2H5 / Tripartite motif-containing protein 42
  
Species: Gallus gallus
  
Chr. number: 9
Strand: 1
Band:
Gene start: 6425974
Gene end: 6434135
  
Corresponding Affymetrix probe sets: GgaAffx.3300.1.S1_at (Chicken Array)   
  
Cross references: Ensembl peptide - ENSGALP00000008463
NCBI entrez gene - 424818     See in Manteia.
RefSeq - XM_422632
swissprot - E1C1V9
Ensembl - ENSGALG00000005286
  
See expression report in BioGPS
See gene description in Wikigenes
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 Q8IWZ5ENSG00000155890Homo sapiens
 Q9D2H5ENSMUSG00000032451Mus musculus


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
No match


Protein motifs (from Interpro)
Interpro ID Name
 IPR000315  B-box-type zinc finger
 IPR001841  Zinc finger, RING-type
 IPR003961  Fibronectin type III
 IPR013083  Zinc finger, RING/FYVE/PHD-type
 IPR013783  Immunoglobulin-like fold
 IPR017907  Zinc finger, RING-type, conserved site


Gene Ontology (GO)
ion bindingion bindingion bindingion bindingion bindingion bindingion bindingion bindingion bindingion bindingion bindingion binding
cellcellcellcellcellcellcellcellcellcellcellcell
TypeGO IDTermEv.Code
 cellular_componentGO:0005622 intracellular IEA
 molecular_functionGO:0008270 zinc ion binding IEA
 molecular_functionGO:0046872 metal ion binding IEA


Pathways (from Reactome)
Pathway description
No match


Phenotype (from MGI, Zfin or HPO)
IDPhenotypeDefinition Genetic BG
No match
  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr