ENSGALG00000006393


Gallus gallus
receptorsignalinggpcrfamilypathwayg-proteincoupledmembraneactivitysecretin-like-likecellsurfaceintegralcomponenttransmembrane

Features
Gene ID: ENSGALG00000006393
  
Biological name :
  
Synonyms :
  
Possible biological names infered from orthology : ADGRG4 / adhesion G protein-coupled receptor G4 / B7ZCC9 / Q8IZF6
  
Species: Gallus gallus
  
Chr. number: 4
Strand: 1
Band:
Gene start: 4336787
Gene end: 4339052
  
Corresponding Affymetrix probe sets:
  
Cross references: Ensembl peptide - ENSGALP00000010309
swissprot - F1P240
Ensembl - ENSGALG00000006393
  
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 adgrg4aENSDARG00000105416Danio rerio
 adgrg4bENSDARG00000094386Danio rerio
 ADGRG4ENSG00000156920Homo sapiens
 Adgrg4ENSMUSG00000053852Mus musculus


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
ADGRG6 / adhesion G protein-coupled receptor G6 / Q6F3F9* / Q86SQ4* / Adhesion G-protein coupled receptor G6 ADGRG6 N-terminal fragment ADGRG6 C-terminal fragment*ENSGALG0000001380352
ADGRG2 / adhesion G protein-coupled receptor G2 / Q8CJ12* / Q8IZP9*ENSGALG0000001651150
ADGRG5 / adhesion G protein-coupled receptor G5 / Q3V3Z3* / Q8IZF4*ENSGALG0000000114935
ADGRG3 / adhesion G protein-coupled receptor G3 / Q86Y34* / Q8R0T6*ENSGALG0000004062735
ADGRG1 / adhesion G protein-coupled receptor G1 / Q8K209* / Q9Y653* / Adhesion G-protein coupled receptor G1 ADGRG1 N-terminal fragment ADGRG1 C-terminal fragment*ENSGALG0000003793930
ADGRG7 / adhesion G protein-coupled receptor G7 / Q8BM96* / Q96K78*ENSGALG0000001529427


Protein motifs (from Interpro)
Interpro ID Name
 IPR000832  GPCR, family 2, secretin-like
 IPR017981  GPCR, family 2-like


Gene Ontology (GO)
cell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcell communicationcellular response to stimuluscellular response to stimulus
signaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activity
membranemembranemembranemembranemembranemembranemembranemembranemembranemembranemembranemembrane
TypeGO IDTermEv.Code
 biological_processGO:0007166 cell surface receptor signaling pathway IEA
 biological_processGO:0007186 G-protein coupled receptor signaling pathway IEA
 cellular_componentGO:0016020 membrane IEA
 cellular_componentGO:0016021 integral component of membrane IEA
 molecular_functionGO:0004888 transmembrane signaling receptor activity IEA
 molecular_functionGO:0004930 G-protein coupled receptor activity IEA


Pathways (from Reactome)
Pathway description
No match


Phenotype (from MGI, Zfin or HPO)
IDPhenotypeDefinition Genetic BG
No match
  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr