ENSGALG00000010596


Gallus gallus
receptorTACR3membraneactivitygrhodopsin-likeneurokininsignalg-proteincoupledsignalingpathwaytachykininspermprotein-couplednkgpcrtmtransductionregulationflagellatedmotilityplasmaintegralcomponentmidpieceobsoletetransduceralphaqsignalling

Features
Gene ID: ENSGALG00000010596
  
Biological name :TACR3
  
Synonyms : Gallus gallus tachykinin receptor 3 (TACR3), mRNA. / TACR3
  
Possible biological names infered from orthology : P29371 / P47937 / tachykinin receptor 3
  
Species: Gallus gallus
  
Chr. number: 4
Strand: 1
Band:
Gene start: 39448857
Gene end: 39482459
  
Corresponding Affymetrix probe sets: GgaAffx.6705.1.S1_at (Chicken Array)   
  
Cross references: Ensembl peptide - ENSGALP00000052435
Ensembl peptide - ENSGALP00000017226
NCBI entrez gene - 768993     See in Manteia.
RefSeq - XM_001232173
RefSeq - NM_001318454
RefSeq Peptide - NP_001305383
swissprot - A0A1D5PI03
swissprot - F1NJ82
Ensembl - ENSGALG00000010596
  
See expression report in BioGPS
See gene description in Wikigenes
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 FO904943.1ENSDARG00000043918Danio rerio
 tacr3aENSDARG00000075112Danio rerio
 tacr3lENSDARG00000003054Danio rerio
 TACR3ENSG00000169836Homo sapiens
 Tacr3ENSMUSG00000028172Mus musculus


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
TACR1 / tachykinin receptor 1 / P25103* / P30548*ENSGALG0000003663854
TACR2 / tachykinin receptor 2 / P21452* / P30549*ENSGALG0000000424842
GPR83 / G protein-coupled receptor 83 / P30731* / Q9NYM4* / Probable G-protein coupled receptor 83 *ENSGALG0000001721226
GPR83L / Gallus gallus G protein-coupled receptor 83-like (GPR83L), mRNA. / Gpr165*ENSGALG0000003739025
PRLHRL / prolactin releasing hormone receptor-like / PRLHR* / Q6VMN6* / P49683* / prolactin releasing hormone receptor* / Prolactin-releasing peptide receptor *ENSGALG0000000314224
NPY1R / neuropeptide Y receptor Y1 / P25929* / Q04573* / Mus musculus neuropeptide Y receptor Y1 (Npy1r), transcript variant 2, mRNA.*ENSGALG0000000949823
Pgr15l*ENSGALG0000003872823
PRLHR2ENSGALG0000003519122
NPY2R / Q9DDN6 / Neuropeptide Y receptor type 2 / P49146* / P97295* / neuropeptide Y receptor Y2*ENSGALG0000000928021
NPY4R / NPY4R2* / P50391* / Q61041* / neuropeptide Y receptor Y4* / neuropeptide Y receptor Y4-2* / Neuropeptide Y receptor type 4 *ENSGALG0000000592320
PROKR2 / prokineticin receptor 1 / PROKR1* / Q9JKL1* / Q8NFJ6* / Q8TCW9* / Q8K458* / prokineticin receptor 2* / Mus musculus prokineticin receptor 1 (Prokr1), transcript variant 2, mRNA.*ENSGALG0000000874120
PRLHR / prolactin-releasing peptide receptor / P49683* / Q6VMN6* / prolactin releasing hormone receptor*ENSGALG0000002065620
NPY6R / Q61212* / Neuropeptide Y receptor type 6 *ENSGALG0000002123520
NPY7RENSGALG0000002130320
NPY5R / neuropeptide Y receptor type 5 / O70342* / Q15761* / neuropeptide Y receptor Y5* / Mus musculus neuropeptide Y receptor Y5 (Npy5r), transcript variant 2, mRNA.*ENSGALG0000000949918


Protein motifs (from Interpro)
Interpro ID Name
 IPR000276  G protein-coupled receptor, rhodopsin-like
 IPR001013  Neurokinin NK3 receptor
 IPR001681  Neurokinin receptor
 IPR017452  GPCR, rhodopsin-like, 7TM


Gene Ontology (GO)
cell communicationcellular response to stimuluslocalization of cellmovement of cell or subcellular componentcell communicationcellular response to stimuluslocalization of cellmovement of cell or subcellular componentcell communicationcellular response to stimuluslocalization of cellmovement of cell or subcellular componentcell communicationcellular response to stimuluslocalization of cellmovement of cell or subcellular componentcell communicationcellular response to stimuluslocalization of cellmovement of cell or subcellular componentcell communicationcellular response to stimuluslocalization of cellmovement of cell or subcellular componentcell communicationcellular response to stimuluslocalization of cellmovement of cell or subcellular componentcell communicationcellular response to stimuluslocalization of cellmovement of cell or subcellular componentcell communicationcellular response to stimuluslocalization of cellmovement of cell or subcellular componentcell communicationcellular response to stimuluslocalization of cellmovement of cell or subcellular componentcell communicationcell communicationcellular response to stimuluscellular response to stimuluslocalization of celllocalization of cellmovement of cell or subcellular commovement of cell or subcellular component
signaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activitysignaling receptor activity
cellmembraneorganellecellmembraneorganellecellmembraneorganellecellmembraneorganellecellmembraneorganellecellmembraneorganellecellmembraneorganellecellmembraneorganellecellmembraneorganellecellmembraneorganellecellcellmembranemembraneorganelleorganelle
TypeGO IDTermEv.Code
 biological_processGO:0007165 signal transduction IEA
 biological_processGO:0007186 G-protein coupled receptor signaling pathway IEA
 biological_processGO:0007217 tachykinin receptor signaling pathway IEA
 biological_processGO:1902093 positive regulation of flagellated sperm motility IEA
 cellular_componentGO:0005886 plasma membrane IEA
 cellular_componentGO:0016020 membrane IEA
 cellular_componentGO:0016021 integral component of membrane IEA
 cellular_componentGO:0097225 sperm midpiece IEA
 molecular_functionGO:0004871 obsolete signal transducer activity IEA
 molecular_functionGO:0004930 G-protein coupled receptor activity IEA
 molecular_functionGO:0004995 tachykinin receptor activity IEA


Pathways (from Reactome)
Pathway description
G alpha (q) signalling events


Phenotype (from MGI, Zfin or HPO)
IDPhenotypeDefinition Genetic BG
No match
  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   

© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr