ENSGALG00000016689


Gallus gallus
o-methyltransferaseASMTLactivitydomainmethyltransferasefamilymaf-likeproteinarsr-likehelix-turn-helixcomt-typeinosinetriphosphatepyrophosphatase-likes-adenosyl-l-methionine-dependentacetylserotonindimerisationmethylationcytosolnucleoside-triphosphatediphosphatase

Features
Gene ID: ENSGALG00000016689
  
Biological name :ASMTL
  
Synonyms : acetylserotonin O-methyltransferase like / ASMTL
  
Possible biological names infered from orthology : O95671
  
Species: Gallus gallus
  
Chr. number: 1
Strand: 1
Band:
Gene start: 129164014
Gene end: 129190488
  
Corresponding Affymetrix probe sets: Gga.14188.1.S1_at (Chicken Array)   GgaAffx.10672.1.S1_at (Chicken Array)   
  
Cross references: Ensembl peptide - ENSGALP00000026877
Ensembl peptide - ENSGALP00000058816
Ensembl peptide - ENSGALP00000044089
NCBI entrez gene - 769097     See in Manteia.
RefSeq - XM_001231913
RefSeq - XM_004938447
swissprot - E1BY36
swissprot - A0A1L1RJ88
swissprot - A0A1D5NUS1
Ensembl - ENSGALG00000016689
  
See expression report in BioGPS
See gene description in Wikigenes
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 asmtlENSDARG00000021433Danio rerio
 ASMTLENSG00000169093Homo sapiens


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
ASMT / acetylserotonin O-methyltransferase / P46597* / Mus musculus acetylserotonin O-methyltransferase (Asmt), transcript variant 1, mRNA.*ENSGALG0000001668523


Protein motifs (from Interpro)
Interpro ID Name
 IPR001077  O-methyltransferase, family 2
 IPR003697  Maf-like protein
 IPR011991  ArsR-like helix-turn-helix domain
 IPR016461  O-methyltransferase COMT-type
 IPR029001  Inosine triphosphate pyrophosphatase-like
 IPR029063  S-adenosyl-L-methionine-dependent methyltransferase
 IPR031725  Acetylserotonin O-methyltransferase, dimerisation domain


Gene Ontology (GO)
methylationmethylationmethylationmethylationmethylationmethylationmethylationmethylationmethylationmethylationmethylationmethylation
transferase activityhydrolase activitytransferase activityhydrolase activitytransferase activityhydrolase activitytransferase activityhydrolase activitytransferase activityhydrolase activitytransferase activityhydrolase activitytransferase activityhydrolase activitytransferase activityhydrolase activitytransferase activityhydrolase activitytransferase activityhydrolase activitytransferase activitytransferase activityhydrolase activityhydrolase activity
cellcellcellcellcellcellcellcellcellcellcellcell
TypeGO IDTermEv.Code
 biological_processGO:0032259 methylation IEA
 cellular_componentGO:0005829 cytosol IEA
 molecular_functionGO:0008168 methyltransferase activity IEA
 molecular_functionGO:0008171 O-methyltransferase activity IEA
 molecular_functionGO:0047429 nucleoside-triphosphate diphosphatase activity IEA


Pathways (from Reactome)
Pathway description
No match


Phenotype (from MGI, Zfin or HPO)
IDPhenotypeDefinition Genetic BG
No match
  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

1 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr