ENSGALG00000021686


Gallus gallus
proteinkinaseactivitycamp-dependentinhibitorregulationserinethreonine

Features
Gene ID: ENSGALG00000021686
  
Biological name :
  
Synonyms :
  
Possible biological names infered from orthology :
  
Species: Gallus gallus
  
Chr. number: 23
Strand: -1
Band:
Gene start: 599141
Gene end: 606391
  
Corresponding Affymetrix probe sets: Gga.10071.1.S1_at (Chicken Array)   
  
Cross references: Ensembl peptide - ENSGALP00000034550
swissprot - F1NVW9
Ensembl - ENSGALG00000021686
  
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 si:ch211-255i3.4ENSDARG00000095152Danio rerio


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
PKIB / cAMP-dependent protein kinase inhibitor beta / Q9C010*ENSGALG0000002703652


Protein motifs (from Interpro)
Interpro ID Name
 IPR004171  cAMP-dependent protein kinase inhibitor


Gene Ontology (GO)
nitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processregulation of molecular functionorganic substance metabolic processnitrogen compound metabolic nitrogen compound metabolic processcellular metabolic processcellular metabolic processprimary metabolic processprimary metabolic processregulation of molecular funcregulation of molecular functionorganic substance metabolic organic substance metabolic process
enzyme regulator activityenzyme regulator activityenzyme regulator activityenzyme regulator activityenzyme regulator activityenzyme regulator activityenzyme regulator activityenzyme regulator activityenzyme regulator activityenzyme regulator activityenzyme regulator activityenzyme regulator activity
TypeGO IDTermEv.Code
 biological_processGO:0006469 negative regulation of protein kinase activity IEA
 biological_processGO:0071901 negative regulation of protein serine/threonine kinase activity IEA
 molecular_functionGO:0004862 cAMP-dependent protein kinase inhibitor activity IEA


Pathways (from Reactome)
Pathway description
No match


Phenotype (from MGI, Zfin or HPO)
IDPhenotypeDefinition Genetic BG
No match
  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   

© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr