ENSGALG00000034218


Gallus gallus
peptidasempagfamilyarsr-likehelix-turn-helixdomainmethionineaminopeptidasesubfamilybindingsitecytoplasmneutrophildegranulation

Features
Gene ID: ENSGALG00000034218
  
Biological name :
  
Synonyms :
  
Possible biological names infered from orthology : AC034102.2 / P50580 / PA2G4 / proliferation-associated 2G4 / Proliferation-associated protein 2G4 / Q9UQ80
  
Species: Gallus gallus
  
Chr. number: 33
Strand: 1
Band:
Gene start: 664989
Gene end: 674193
  
Corresponding Affymetrix probe sets: Gga.7121.1.S1_at (Chicken Array)   GgaAffx.23029.1.S1_at (Chicken Array)   GgaAffx.26679.1.S1_at (Chicken Array)   
  
Cross references: Ensembl peptide - ENSGALP00000048615
Ensembl peptide - ENSGALP00000062511
NCBI entrez gene - 425279     See in Manteia.
RefSeq - XM_015300308
swissprot - A0A1D5P7C6
swissprot - A0A1L1RUL6
Ensembl - ENSGALG00000034218
  
See expression report in BioGPS
See gene description in Wikigenes
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 pa2g4aENSDARG00000039578Danio rerio
 pa2g4bENSDARG00000070657Danio rerio
 AC034102.2ENSG00000257411Homo sapiens
 PA2G4ENSG00000170515Homo sapiens
 Pa2g4ENSMUSG00000025364Mus musculus


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
METAP2 / methionine aminopeptidase 2 / O08663* / P50579* / methionyl aminopeptidase 2*ENSGALG0000001137718


Protein motifs (from Interpro)
Interpro ID Name
 IPR000994  Peptidase M24
 IPR004545  PA2G4 family
 IPR011991  ArsR-like helix-turn-helix domain
 IPR018349  Peptidase M24A, methionine aminopeptidase, subfamily 2, binding site


Gene Ontology (GO)
cellcellcellcellcellcellcellcellcellcellcellcell
TypeGO IDTermEv.Code
 cellular_componentGO:0005737 cytoplasm IEA


Pathways (from Reactome)
Pathway description
Neutrophil degranulation


Phenotype (from MGI, Zfin or HPO)
IDPhenotypeDefinition Genetic BG
No match
  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr