ENSMUSG00000019996


Mus musculus
cellMap7smallseminiferousmaledecreasedmicrotubule-associatedproteinmicrotubulecytoskeletontestisgermtubulesertolifamilyorganizationcytosolleydighyperplasiatubulesinfertilityspermiogenesisdepletionlengthallograftsurvivalweightepididymisspermatidectopiccells

Features
Gene ID: ENSMUSG00000019996
  
Biological name :Map7
  
Synonyms : Map7 / microtubule associated protein 7
  
Possible biological names infered from orthology : Q14244
  
Species: Mus musculus
  
Chr. number: 10
Strand: 1
Band: A3
Gene start: 20148471
Gene end: 20281590
  
Corresponding Affymetrix probe sets: 10361956 (MoGene1.0st)   1421835_at (Mouse Genome 430 2.0 Array)   1421836_at (Mouse Genome 430 2.0 Array)   1429894_a_at (Mouse Genome 430 2.0 Array)   1432983_at (Mouse Genome 430 2.0 Array)   
  
Cross references: Ensembl peptide - ENSMUSP00000151101
Ensembl peptide - ENSMUSP00000149367
Ensembl peptide - ENSMUSP00000020173
Ensembl peptide - ENSMUSP00000111963
Ensembl peptide - ENSMUSP00000150818
NCBI entrez gene - 17761     See in Manteia.
MGI - MGI:1328328
RefSeq - XM_006512585
RefSeq - XM_006512578
RefSeq - XM_006512579
RefSeq - XM_006512580
RefSeq - XM_006512581
RefSeq - XM_006512582
RefSeq - XM_006512583
RefSeq - XM_006512584
RefSeq - NM_001198635
RefSeq - NM_008635
RefSeq - XM_006512577
RefSeq Peptide - NP_032661
RefSeq Peptide - NP_001185564
swissprot - A0A1L1SVB6
swissprot - E9QMU3
swissprot - A0A1L1SR93
swissprot - A0A1L1SUN4
swissprot - D3YWN7
Ensembl - ENSMUSG00000019996
  
See expression report in BioGPS
See gene description in Wikigenes
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 map7aENSDARG00000078241Danio rerio
 si:ch73-217b7.1ENSDARG00000104435Danio rerio
 MAP7ENSGALG00000013900Gallus gallus
 MAP7ENSG00000135525Homo sapiens


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
A2AJI0 / Map7d1 / Mus musculus MAP7 domain containing 1 (Map7d1), transcript variant 3, mRNA. / Q3KQU3* / MAP7 domain containing 1*ENSMUSG0000002884937
A2AG50 / Map7d2 / MAP7 domain-containing protein 2 / Q96T17* / MAP7 domain containing 2*ENSMUSG0000004102028
A2AEY4 / Map7d3 / MAP7 domain-containing protein 3 / Q8IWC1* / MAP7 domain containing 3*ENSMUSG0000006787818


Protein motifs (from Interpro)
Interpro ID Name
 IPR008604  Microtubule-associated protein 7 family
 IPR030707  Microtubule-associated protein 7


Gene Ontology (GO)
cellular component organizationmicrotubule-based processcellular component organizationmicrotubule-based processcellular component organizationmicrotubule-based processcellular component organizationmicrotubule-based processcellular component organizationmicrotubule-based processcellular component organizationmicrotubule-based processcellular component organizationmicrotubule-based processcellular component organizationmicrotubule-based processcellular component organizationmicrotubule-based processcellular component organizationmicrotubule-based processcellular component organizationcellular component organizationmicrotubule-based processmicrotubule-based process
cellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellcellorganelleorganelle
TypeGO IDTermEv.Code
 biological_processGO:0000226 microtubule cytoskeleton organization IEA
 cellular_componentGO:0005829 cytosol IEA
 cellular_componentGO:0015630 microtubule cytoskeleton IEA


Pathways (from Reactome)
Pathway description
No match


Phenotype (from MGI, Zfin or HPO)
endocrine/exocrine gland phenotypereproductive system phenotypecellular phenotypeimmune system phenotypeendocrine/exocrine gland phenotypereproductive system phenotypecellular phenotypeimmune system phenotypeendocrine/exocrine gland phenotypereproductive system phenotypecellular phenotypeimmune system phenotypeendocrine/exocrine gland phenotypereproductive system phenotypecellular phenotypeimmune system phenotypeendocrine/exocrine gland phenotypereproductive system phenotypecellular phenotypeimmune system phenotypeendocrine/exocrine gland phenotypereproductive system phenotypecellular phenotypeimmune system phenotypeendocrine/exocrine gland phenotypereproductive system phenotypecellular phenotypeimmune system phenotypeendocrine/exocrine gland phenotypereproductive system phenotypecellular phenotypeimmune system phenotypeendocrine/exocrine gland phenotypereproductive system phenotypecellular phenotypeimmune system phenotypeendocrine/exocrine gland phenotypereproductive system phenotypecellular phenotypeimmune system phenotypeendocrine/exocrine gland phenotypeendocrine/exocrine gland phenotypereproductive system phenotypereproductive system phenotypecellular phenotypecellular phenotypeimmune system phenotypeimmune system phenotype
IDPhenotypeDefinition Genetic BG
 MP:0001147 small testis "reduced size of the male reproductive glands" [Stedman s Medical Dictionary:ISBN 0-683-40008-8, J:58959]
Show

Allelic Composition: MipHfi/MipHfi
Genetic Background: involves: 101 * C3H

Allelic Composition: Map7Gt(ROSABetageo)1Sor/Map7mshi
Genetic Background: involves: 129S4/SvJaeSor * BALB/cBy * C57BL/6J

Allelic Composition: Map7Gt(ROSABetageo)1Sor/Map7Gt(ROSABetageo)1Sor
Genetic Background: involves: 129S4/SvJaeSor * C57BL/6J

 MP:0001152 Leydig cell hyperplasia "increased number of interstitial cells of the seminiferous tubules that secrete testosterone" [J:45065]
Show

Allelic Composition: MipHfi/MipHfi
Genetic Background: involves: 101 * C3H

Allelic Composition: Map7mshi/Map7mshi
Genetic Background: BALB/cBy

 MP:0001153 small seminiferous tubules "reduced diameter of the tubules in the testes where spermatogenesis occurs" [J:50844]
Show

Allelic Composition: MipHfi/MipHfi
Genetic Background: involves: 101 * C3H

Allelic Composition: Map7mshi/Map7mshi
Genetic Background: B6.CBy-Map7mshi/Csu

Allelic Composition: Map7Gt(ROSABetageo)1Sor/Map7mshi
Genetic Background: involves: 129S4/SvJaeSor * BALB/cBy * C57BL/6J

Allelic Composition: Map7Gt(ROSABetageo)1Sor/Map7Gt(ROSABetageo)1Sor
Genetic Background: involves: 129S4/SvJaeSor * C57BL/6J

 MP:0001925 male infertility "inability of male to produce live offspring" [Stedman s Medical Dictionary:ISBN 0-683-40008-8, J:60409]
Show

Allelic Composition: MipHfi/MipHfi
Genetic Background: involves: 101 * C3H

Allelic Composition: Map7mshi/Map7mshi
Genetic Background: BALB/cBy

Allelic Composition: Map7mshi/Map7mshi
Genetic Background: B6.CBy-Map7mshi/Csu

Allelic Composition: Map7Gt(ROSABetageo)1Sor/Map7mshi
Genetic Background: involves: 129S4/SvJaeSor * BALB/cBy * C57BL/6J

Allelic Composition: Map7Gt(ROSABetageo)1Sor/Map7Gt(ROSABetageo)1Sor
Genetic Background: involves: 129S4/SvJaeSor * C57BL/6J

 MP:0001932 abnormal spermiogenesis "failure of sperm cells to form or differentiate" [Stedman s Medical Dictionary , 27th edition:ISBN 0-683-40008-8, csmith:Cynthia L. Smith , Mouse Genome Informatics Curator]
Show

Allelic Composition: MipHfi/MipHfi
Genetic Background: involves: 101 * C3H

 MP:0002209 germ cell depletion "reduced numbers of any of the reproductive (generative) cells of a multicellular organism, whether they are undifferentiated or fully differentiated" [pvb:Pierre Vanden Borre , Mouse Genome Informatics Curator, Stedman s Medical Dictionary:ISBN 0-683-40008-8]
Show

Allelic Composition: MipHfi/MipHfi
Genetic Background: involves: 101 * C3H

 MP:0002216 abnormal seminiferous tubule morphology "malformation of the tubules in the testes where spermatogenesis occurs" [Stedman s Medical Dictionary , 27th edition:ISBN 0-683-40008-8, csmith:Cynthia L. Smith , Mouse Genome Informatics Curator]
Show

Allelic Composition: Sigirrtm1Mant/Sigirrtm1Mant
Genetic Background: involves: 129S1/Sv * 129X1/SvJ * C57BL/6J

Allelic Composition: Map7mshi/Map7mshi
Genetic Background: B6.CBy-Map7mshi/Csu

Allelic Composition: Map7Gt(ROSABetageo)1Sor/Map7mshi
Genetic Background: involves: 129S4/SvJaeSor * BALB/cBy * C57BL/6J

Allelic Composition: Map7Gt(ROSABetageo)1Sor/Map7Gt(ROSABetageo)1Sor
Genetic Background: involves: 129S4/SvJaeSor * C57BL/6J

 MP:0002784 abnormal Sertoli cell morphology "malformation of the cells of the seminiferous tubules that create the blood-testes barrier and enable spermatogenesis" [J:65900, pvb:Pierre Vanden Borre , Mouse Genome Informatics Curator]
Show

Allelic Composition: MipHfi/MipHfi
Genetic Background: involves: 101 * C3H

 MP:0004752 decreased length of allograft survival "compared to controls, a reduced length of time that transplanted tissue, in which the donor and recipient are genetically similar (same species) but not genetically identical, retains function and/or remains alive" [MGI:csmith "Cynthia L. Smith, Mouse Genome Informatics Curator"]
Show

Allelic Composition: Map7mshi/Map7mshi
Genetic Background: BALB/cBy

 MP:0004852 decreased testis weight "reduced average weight of the male reproductive glands" [MGI:csmith "Cynthia L. Smith, Mouse Genome Informatics Curator"]
Show

Allelic Composition: Map7mshi/Map7mshi
Genetic Background: B6.CBy-Map7mshi/Csu

Allelic Composition: Map7Gt(ROSABetageo)1Sor/Map7mshi
Genetic Background: involves: 129S4/SvJaeSor * BALB/cBy * C57BL/6J

Allelic Composition: Map7Gt(ROSABetageo)1Sor/Map7Gt(ROSABetageo)1Sor
Genetic Background: involves: 129S4/SvJaeSor * C57BL/6J

 MP:0004901 decreased male germ cell number "reduced numbers of male germ cells whether they are undifferentiated or fully differentiated" [MGI:llw2 "Linda Washburn, Mouse Genome Informatics Curator", MGI:smb "Susan M. Bello, Mouse Genome Informatics Curator"]
Show

Allelic Composition: Map7Gt(ROSABetageo)1Sor/Map7mshi
Genetic Background: involves: 129S4/SvJaeSor * BALB/cBy * C57BL/6J

 MP:0004930 small epididymis "decrease in the average size of the elongated structure connected to the posterior surface of the testis that transports, stores, and matures spermatozoa between testis and vas deferens" [MGI:csmith "Cynthia L. Smith, Mouse Genome Informatics Curator"]
Show

Allelic Composition: MipHfi/MipHfi
Genetic Background: involves: 101 * C3H

 MP:0006380 abnormal spermatid morphology "anomaly in the number or structure of the male germ cells that without further cell division give rise to mature spermatozoa" [ISBN:0-8036-0655-99 "Taber s Cyclopedic Medical Dictionary, 19th edition", MGI:smb "Susan M. Bello, Mouse Genome Informatics Curator"]
Show

Allelic Composition: MipHfi/MipHfi
Genetic Background: involves: 101 * C3H

 MP:0006428 ectopic Sertoli cells "abnormal position of the cells of the seminiferous tubules that create the blood-testes barrier and enable spermatogenesis" [J:71710, MGI:anna "Anna V. Anagnostopoulos, Mouse Genome Informatics Curator"]
Show

Allelic Composition: Map7mshi/Map7mshi
Genetic Background: BALB/cBy

 MP:0008261 arrest of male meiosis "cessation of the progression of the process of nuclear division that results in sperm with one half the normal chromosome number of the original cell" [ISBN:0-683-40008-8 "Stedman s Medical Dictionary, 27th edition"]
Show

Allelic Composition: Map7mshi/Map7mshi
Genetic Background: BALB/cBy

 MP:0011750 abnormal seminiferous tubule epithelium morphology "any structural anomaly of the stratified epithelial lining of the seminiferous tubules, consisting of the developing spermatozoa and the supporting Sertoli cells, which are tall, columnar type cells that line the tubule" [MGI:csmith]
Show

Allelic Composition: Map7mshi/Map7mshi
Genetic Background: BALB/cBy

  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr