ENSMUSG00000069036


Mus musculus
sexSrytranscriptionbindingfactordeterminationmaleregulationdevelopmentactivitydnatestissecondaryreversalhighmobilitygroupboxdomainrnapolymeraseiidna-templateddifferentiationnuclearcomplexproteinovarianinfertilityprimarydecreased

Features
Gene ID: ENSMUSG00000069036
  
Biological name :Sry
  
Synonyms : Q05738 / sex determining region of Chr Y / Sry
  
Possible biological names infered from orthology : Q05066 / sex determining region Y
  
Species: Mus musculus
  
Chr. number: Y
Strand: -1
Band: A1
Gene start: 2662471
Gene end: 2663658
  
Corresponding Affymetrix probe sets: 10608193 (MoGene1.0st)   1450578_at (Mouse Genome 430 2.0 Array)   1450579_x_at (Mouse Genome 430 2.0 Array)   
  
Cross references: Ensembl peptide - ENSMUSP00000088717
NCBI entrez gene - 21674     See in Manteia.
MGI - MGI:98660
RefSeq - NM_011564
RefSeq Peptide - NP_035694
swissprot - Q05738
swissprot - Q53WV7
Ensembl - ENSMUSG00000069036
  

This gene has been taged as a transcription factor by TFT
See expression report in BioGPS
See gene description in Wikigenes
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 SRYENSG00000184895Homo sapiens


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
Sox3 / SRY-box 3 / P41225*ENSMUSG0000004517917
Sox1 / P53783 / Transcription factor SOX-1 / O00570* / SRY-box 1*ENSMUSG0000009601417
Sox9 / Q04887 / Transcription factor SOX-9 / P48436* / SRY-box 9*ENSMUSG0000000056716
Sox2 / SRY-box 2 / P48431*ENSMUSG0000007463716
Sox17 / Q61473 / Transcription factor SOX-17 / Q9H6I2* / SRY-box 17*ENSMUSG0000002590215
Sox10 / Q04888 / Transcription factor SOX-10 / P56693* / SRY-box 10*ENSMUSG0000003300615
Sox21 / Q811W0 / Transcription factor SOX-21 / Q9Y651* / SRY-box 21*ENSMUSG0000006151715
Sox7 / P40646 / SRY (sex determining region Y)-box 7 / Q9BT81* / SRY-box 7*ENSMUSG0000006306015
Sox8 / Q04886 / SRY (sex determining region Y)-box 8 / P57073* / SRY-box 8*ENSMUSG0000002417614
Sox15 / P43267 / SRY (sex determining region Y)-box 15 / O60248* / SRY-box 15*ENSMUSG0000004128714
Sox18 / P43680 / Transcription factor SOX-18 / P35713* / SRY-box 18*ENSMUSG0000004647014
Sox14 / Q04892 / Transcription factor SOX-14 / O95416* / SRY-box 14*ENSMUSG0000005374714
Sox11 / Q7M6Y2 / Transcription factor SOX-11 / P35716* / SRY-box 11*ENSMUSG0000006363214
Sox4 / Q06831 / Transcription factor SOX-4 / Q06945* / SRY-box 4*ENSMUSG0000007643114
Sox12 / Q04890 / Transcription factor SOX-12 / O15370* / SRY-box 12*ENSMUSG0000005181713


Protein motifs (from Interpro)
Interpro ID Name
 IPR009071  High mobility group box domain
 IPR017253  Transcription factor SRY
 IPR036910  High mobility group box domain superfamily


Gene Ontology (GO)
nitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcellular developmental processnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcellular developmental processnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcellular developmental processnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcellular developmental processnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcellular developmental processnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcellular developmental processnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcellular developmental processnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcellular developmental processnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcellular developmental processnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processanatomical structure developmentcellular developmental processnitrogen compound menitrogen compound metabolic processbiosynthetic processbiosynthetic processcellular metabolic pcellular metabolic processprimary metabolic prprimary metabolic processorganic substance meorganic substance metabolic processanatomical structureanatomical structure developmentcellular developmentcellular developmental process
DNA-binding transcription factor activityorganic cyclic compound bindingheterocyclic compound bindingprotein bindingDNA-binding transcription factor activityorganic cyclic compound bindingheterocyclic compound bindingprotein bindingDNA-binding transcription factor activityorganic cyclic compound bindingheterocyclic compound bindingprotein bindingDNA-binding transcription factor activityorganic cyclic compound bindingheterocyclic compound bindingprotein bindingDNA-binding transcription factor activityorganic cyclic compound bindingheterocyclic compound bindingprotein bindingDNA-binding transcription factor activityorganic cyclic compound bindingheterocyclic compound bindingprotein bindingDNA-binding transcription factor activityorganic cyclic compound bindingheterocyclic compound bindingprotein bindingDNA-binding transcription factor activityorganic cyclic compound bindingheterocyclic compound bindingprotein bindingDNA-binding transcription factor activityorganic cyclic compound bindingheterocyclic compound bindingprotein bindingDNA-binding transcription factor activityorganic cyclic compound bindingheterocyclic compound bindingprotein bindingDNA-binding transcription factor acDNA-binding transcription factor activityorganic cyclic compound bindingorganic cyclic compound bindingheterocyclic compound bindingheterocyclic compound bindingprotein bindingprotein binding
cellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellorganellemembrane-enclosed lumenprotein-containing complexcellcellorganelleorganellemembrane-enclosed lumenmembrane-enclosed lumenprotein-containing complexprotein-containing complex
TypeGO IDTermEv.Code
 biological_processGO:0000122 negative regulation of transcription by RNA polymerase II IGI
 biological_processGO:0006351 transcription, DNA-templated IEA
 biological_processGO:0006355 regulation of transcription, DNA-templated IEA
 biological_processGO:0007530 sex determination IGI
 biological_processGO:0007548 sex differentiation IEA
 biological_processGO:0008584 male gonad development IDA
 biological_processGO:0010629 negative regulation of gene expression IDA
 biological_processGO:0030154 cell differentiation IEA
 biological_processGO:0030238 male sex determination IGI
 cellular_componentGO:0005634 nucleus IDA
 cellular_componentGO:0005737 cytoplasm IEA
 cellular_componentGO:0016607 nuclear speck IEA
 cellular_componentGO:0044798 nuclear transcription factor complex IDA
 molecular_functionGO:0000981 RNA polymerase II transcription factor activity, sequence-specific DNA binding IDA
 molecular_functionGO:0003677 DNA binding IDA
 molecular_functionGO:0003700 DNA-binding transcription factor activity IEA
 molecular_functionGO:0005515 protein binding IPI
 molecular_functionGO:0005516 calmodulin binding IEA
 molecular_functionGO:0008301 DNA binding, bending IDA
 molecular_functionGO:0046982 protein heterodimerization activity IDA


Pathways (from Reactome)
Pathway description
Deactivation of the beta-catenin transactivating complex


Phenotype (from MGI, Zfin or HPO)
endocrine/exocrine gland phenotypereproductive system phenotypehomeostasis/metabolism phenotypecellular phenotypemortality/agingendocrine/exocrine gland phenotypereproductive system phenotypehomeostasis/metabolism phenotypecellular phenotypemortality/agingendocrine/exocrine gland phenotypereproductive system phenotypehomeostasis/metabolism phenotypecellular phenotypemortality/agingendocrine/exocrine gland phenotypereproductive system phenotypehomeostasis/metabolism phenotypecellular phenotypemortality/agingendocrine/exocrine gland phenotypereproductive system phenotypehomeostasis/metabolism phenotypecellular phenotypemortality/agingendocrine/exocrine gland phenotypereproductive system phenotypehomeostasis/metabolism phenotypecellular phenotypemortality/agingendocrine/exocrine gland phenotypereproductive system phenotypehomeostasis/metabolism phenotypecellular phenotypemortality/agingendocrine/exocrine gland phenotypereproductive system phenotypehomeostasis/metabolism phenotypecellular phenotypemortality/agingendocrine/exocrine gland phenotypereproductive system phenotypehomeostasis/metabolism phenotypecellular phenotypemortality/agingendocrine/exocrine gland phenotypereproductive system phenotypehomeostasis/metabolism phenotypecellular phenotypemortality/agingendocrine/exocrine gland pheendocrine/exocrine gland phenotypereproductive system phenotypreproductive system phenotypehomeostasis/metabolism phenohomeostasis/metabolism phenotypecellular phenotypecellular phenotypemortality/agingmortality/aging
IDPhenotypeDefinition Genetic BG
 MP:0001131 abnormal ovarian follicles "malformed or absent sac-like structure in the ovary which surrounds an ovum" [Stedman s Medical Dictionary:ISBN 0-683-40008-8, J:33042]
Show

Allelic Composition: Oca2p-d/Oca2p-d
Genetic Background: Not Specified

 MP:0001147 small testis "reduced size of the male reproductive glands" [Stedman s Medical Dictionary:ISBN 0-683-40008-8, J:58959]
Show

Allelic Composition: Inpp5dtm1Rkh/Inpp5dtm1Rkh
Genetic Background: involves: 129S1/Sv * 129X1/SvJ * C57BL/6J

Allelic Composition: KitW-19H/Kit+,X/SryAKR/J
Genetic Background: involves: AKR/J * C57BL/6J

Allelic Composition: Map3k4tm1Flv/Map3k4+,X/SryAKR/J
Genetic Background: B6.Cg-Map3k4tm1Flv Chr YAKR

 MP:0001925 male infertility "inability of male to produce live offspring" [Stedman s Medical Dictionary:ISBN 0-683-40008-8, J:60409]
Show

Allelic Composition: Htr1atm1Tct/Htr1a+
Genetic Background: involves: 129X1/SvJ * C57BL/6J

 MP:0001926 female infertility "inability of female to produce live offspring" [Stedman s Medical Dictionary:ISBN 0-683-40008-8, J:34193]
Show

Allelic Composition: Oca2p-d/Oca2p-d
Genetic Background: Not Specified

 MP:0001939 secondary sex reversal "secondary sexual phenotype is not consistent with the chromosomal sex, i.e., internal and/or external genitalia are inconsistent with chromosomal sex " [llw2:Linda Washburn , Mouse Genome Informatics Curator]
Show

Allelic Composition: A/?,DctSlt-lt/Dct+
Genetic Background: involves: C3H/HeJ

Allelic Composition: X/SryCB
Genetic Background: C57BL/6JEi-Chr YCB/EiJ

 MP:0002211 abnormal primary sex determination "aberrant gonadal development resulting in either abnormal or absent gonads or the development of gonads inconsistent with the chromosomal sex " [llw2:Linda Washburn , Mouse Genome Informatics Curator, csmith:Cynthia L. Smith , Mouse Genome Informatics Curator]
Show

Allelic Composition: A/?,DctSlt-lt/Dct+
Genetic Background: involves: C3H/HeJ

Allelic Composition: X/SryCB
Genetic Background: C57BL/6JEi-Chr YCB/EiJ

 MP:0002212 abnormal secondary sex determination "gonadal development may or may not be normal, and the phenotype of the animal outside the gonad does not match chromosomal sex or is ambiguous" [llw2:Linda Washburn , Mouse Genome Informatics Curator]
Show

Allelic Composition: A/?,DctSlt-lt/Dct+
Genetic Background: involves: C3H/HeJ

Allelic Composition: X/SryCB
Genetic Background: C57BL/6JEi-Chr YCB/EiJ

 MP:0002213 true hermaphroditism "having both ovarian and testicular tissue present" [Stedman s Medical Dictionary , 27th edition:ISBN 0-683-40008-8, llw2:Linda Washburn , Mouse Genome Informatics Curator]
Show

Allelic Composition: A/?,DctSlt-lt/Dct+
Genetic Background: involves: C3H/HeJ

Allelic Composition: KitW-42J/Kit+,X/SryAKR/J
Genetic Background: involves: AKR/J * C57BL/6J

Allelic Composition: KitW-42J/Kit+,X/SryPOS-TIR
Genetic Background: involves: C57BL/6J

Allelic Composition: X/SryCB
Genetic Background: C57BL/6JEi-Chr YCB/EiJ

 MP:0002995 primary sex reversal "gonad type is not consistent with chromosomal sex" [llw2:Linda Washburn , Mouse Genome Informatics Curator]
Show

Allelic Composition: Prkar2btm1Gsm/Prkar2btm1Gsm
Genetic Background: B6.129-Prkar2btm1Gsm

Allelic Composition: X/Srydl1Rlb,Tg(Sry)2Ei/0
Genetic Background: involves: 129S6/SvEv * C3H * C57BL/6JEi * MF1

Allelic Composition: X/SryPOS
Genetic Background: C57BL/6J

Allelic Composition: X/SryCB
Genetic Background: C57BL/6JEi-Chr YCB/EiJ

Allelic Composition: Map3k4tm1Flv/Map3k4+,X/SryAKR/J
Genetic Background: B6.Cg-Map3k4tm1Flv Chr YAKR

Allelic Composition: Gadd45gtm1Jni/Gadd45g+,X/SryAKR/J
Genetic Background: involves: 129P2/OlaHsd * AKR/J * C57BL/6J

Allelic Composition: X/Sryem1Takas
Genetic Background: involves: C57BL/6 * DBA/2

 MP:0002996 ovotestis "gonad with both ovarian and testicular tissue" [llw2:Linda Washburn , Mouse Genome Informatics Curator]
Show

Allelic Composition: A/?,DctSlt-lt/Dct+
Genetic Background: involves: C3H/HeJ

Allelic Composition: X/SryCB
Genetic Background: C57BL/6JEi-Chr YCB/EiJ

Allelic Composition: Map3k4tm1Flv/Map3k4+,X/SryAKR/J
Genetic Background: B6.Cg-Map3k4tm1Flv Chr YAKR

Allelic Composition: Gadd45gtm1Jni/Gadd45g+,X/SryAKR/J
Genetic Background: involves: 129P2/OlaHsd * AKR/J * C57BL/6J

 MP:0003830 abnormal testis development "abnormal morphogenesis of the male reproductive gland containing the germ cells" [smb:Susan M Bello, Mouse Genome Informatics Curator, J:100020]
Show

Allelic Composition: Gadd45gtm1Jni/Gadd45g+,X/SryAKR/J
Genetic Background: involves: 129P2/OlaHsd * AKR/J * C57BL/6J

 MP:0004852 decreased testis weight "reduced average weight of the male reproductive glands" [MGI:csmith "Cynthia L. Smith, Mouse Genome Informatics Curator"]
Show

Allelic Composition: Notch2tm2Grid/Notch2tm3Grid,Speer6-ps1Tg(Alb-cre)21Mgn/Speer6-ps1+
Genetic Background: involves: 129S1/Sv * C57BL/6 * DBA

Allelic Composition: KitW-e/Kit+,X/SryAKR/J
Genetic Background: involves: AKR/J * C57BL/6J

Allelic Composition: KitW-27H/Kit+,X/SryAKR/J
Genetic Background: involves: AKR/J * C57BL/6J * CBA/H

Allelic Composition: Del(10)1H/+,X/SryAKR/J
Genetic Background: involves: AKR/J * C57BL/6J

Allelic Composition: KitlSl-18H/Kitl+,X/SryAKR/J
Genetic Background: involves: AKR/J * C57BL/6J

Allelic Composition: X/SryAKR/J,Tht/Tht+
Genetic Background: involves: AKR/J * C57BL/6J

 MP:0005180 abnormal circulating testosterone level "aberration in the blood concentration of this most potent androgen" [cwg:Carroll-Ann W. Goldsmith , Mouse Genome Informatics curator]
Show

Allelic Composition: Oca2p-d/Oca2p-d
Genetic Background: Not Specified

 MP:0005652 sex reversal "development of the reproductive system is inconsistent with the chromosomal sex " [llw2:Linda Washburn , Mouse Genome Informatics Curator]
Show

Allelic Composition: X/SryPOS
Genetic Background: C57BL/6J

Allelic Composition: KitW-42J/Kit+,X/SryPOS-TIR
Genetic Background: involves: C57BL/6J

Allelic Composition: KitW-19H/Kit+,X/SryAKR/J
Genetic Background: involves: AKR/J * C57BL/6J

 MP:0008898 abnormal acrosome morphology "any structural anomaly of the cap-like structure at the anterior end of the sperm head that produces enzymes needed for egg penetration" [MESH:A05.360.490.890.820.100]
Show

Allelic Composition: Htr1atm1Tct/Htr1a+
Genetic Background: involves: 129X1/SvJ * C57BL/6J

 MP:0009017 prolonged estrus "increase in the length of the estrous phase of the estrous cycle in female animals" [MGI:anna "Anna V. Anagnostopoulos, Mouse Genome Informatics Curator"]
Show

Allelic Composition: X/Sryem1Takas
Genetic Background: involves: C57BL/6 * DBA/2

 MP:0009205 abnormal internal male genitalia morphology "any structural anomaly of the internal masculine genital organs, including the testes, epididymides, deferent ducts, seminal vesicles, prostate, ejaculatory ducts, and bulbourethral glands" [MGI:anna "Anna V. Anagnostopoulos, Mouse Genome Informatics Curator"]
Show

Allelic Composition: KitW-42J/Kit+,X/SryAKR/J
Genetic Background: involves: AKR/J * C57BL/6J

 MP:0011109 partial lethality throughout fetal growth and development "the appearance of lower than Mendelian ratios of organisms of a given genotype due to death of some, but not all of the organisms between the completion of organogenesis and birth (Mus: E14 to approximately E18.5)" [MGI:csmith]
Show

Allelic Composition: KitW-42J/Kit+,X/SryAKR/J
Genetic Background: involves: AKR/J * C57BL/6J

 MP:0011129 decreased secondary ovarian follicle number "fewer than normal numbers of the ovarian follicle in which the primary oocyte attains its full size and is surrounded by an extracellular glycoprotein layer (zona pellucida) that separates it from a peripheral layer of follicular cells permeated by one or more fluid-filled antra; the primary oocyte occupies the cumulus oophorus while the theca of the follicle develops into internal and external layers" [MGI:csmith]
Show

Allelic Composition: X/Sryem1Takas
Genetic Background: involves: C57BL/6 * DBA/2

  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr