27031


Homo sapiens (NCBI)
determinationleftrightpathwayasymmetrydevelopmentwntsignalingcellinvolvedciliumregulationkidneymaintenanceplanarpolarityheartloopingatrialseptumsymmetrylungpancreaticphotoreceptoranimalorganidentityconvergentextensiongastrulation

Features
Gene ID: 27031
  
Biological name :
  
Synonyms : CFAP31|MKS7|NPH3|RHPD|RHPD1|SLSN3 / nephrocystin 3 / NPHP3
  
Possible biological names infered from orthology :
  
Species: Homo sapiens (NCBI)
  
Chr. number:
Strand:
Band:
Gene start:
Gene end:
  
Corresponding Affymetrix probe sets: 1553389_at (Human Genome U133 Plus 2.0 Array)   225573_at (Human Genome U133 Plus 2.0 Array)   235410_at (Human Genome U133 Plus 2.0 Array)   235432_at (Human Genome U133 Plus 2.0 Array)   
  
Cross references: RefSeq - 34304360
RefSeq - NC_000003.12
RefSeq - NG_008130.1
RefSeq - NP_694972.3
RefSeq - NM_153240.4
  
See co-cited genes in PubMed
Warning: Please see the Ensembl gene model ENSG00000113971 to get all the annotations available for this gene.


Gene Ontology (GO)
anatomical structure developmentcell communicationcellular response to stimulusregulation of biological qualitycellular developmental processcellular component organizationcellular component biogenesismovement of cell or subcellular componentmicrotubule-based processanatomical structure developmentcell communicationcellular response to stimulusregulation of biological qualitycellular developmental processcellular component organizationcellular component biogenesismovement of cell or subcellular componentmicrotubule-based processanatomical structure developmentcell communicationcellular response to stimulusregulation of biological qualitycellular developmental processcellular component organizationcellular component biogenesismovement of cell or subcellular componentmicrotubule-based processanatomical structure developmentcell communicationcellular response to stimulusregulation of biological qualitycellular developmental processcellular component organizationcellular component biogenesismovement of cell or subcellular componentmicrotubule-based processanatomical structure developmentcell communicationcellular response to stimulusregulation of biological qualitycellular developmental processcellular component organizationcellular component biogenesismovement of cell or subcellular componentmicrotubule-based processanatomical structure developmentcell communicationcellular response to stimulusregulation of biological qualitycellular developmental processcellular component organizationcellular component biogenesismovement of cell or subcellular componentmicrotubule-based processanatomical structure developmentcell communicationcellular response to stimulusregulation of biological qualitycellular developmental processcellular component organizationcellular component biogenesismovement of cell or subcellular componentmicrotubule-based processanatomical structure developmentcell communicationcellular response to stimulusregulation of biological qualitycellular developmental processcellular component organizationcellular component biogenesismovement of cell or subcellular componentmicrotubule-based processanatomical structure developmentcell communicationcellular response to stimulusregulation of biological qualitycellular developmental processcellular component organizationcellular component biogenesismovement of cell or subcellular componentmicrotubule-based processanatomical structure developmentcell communicationcellular response to stimulusregulation of biological qualitycellular developmental processcellular component organizationcellular component biogenesismovement of cell or subcellular componentmicrotubule-based processanatomical struanatomical structure developmentcell communicatcell communicationcellular responcellular response to stimulusregulation of bregulation of biological qualitycellular develocellular developmental processcellular componcellular component organizationcellular componcellular component biogenesismovement of celmovement of cell or subcellular componentmicrotubule-basmicrotubule-based process
protein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein binding
cellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellorganellecellcellorganelleorganelle
TypeGO IDTermEv.Code
 biological_processGO:0001822 kidney development IMP
 biological_processGO:0001947 heart looping IMP
 biological_processGO:0003283 atrial septum development IMP
 biological_processGO:0007368 determination of left/right symmetry IMP
 biological_processGO:0016055 Wnt signaling pathway IEA
 biological_processGO:0030324 lung development IMP
 biological_processGO:0035469 determination of pancreatic left/right asymmetry IMP
 biological_processGO:0045494 photoreceptor cell maintenance IMP
 biological_processGO:0048496 maintenance of animal organ identity IMP
 biological_processGO:0060027 convergent extension involved in gastrulation IGI
 biological_processGO:0060271 cilium assembly ISS
 biological_processGO:0060287 epithelial cilium movement involved in determination of left/right asymmetry IC
 biological_processGO:0060993 kidney morphogenesis IMP
 biological_processGO:0071908 determination of intestine left/right asymmetry IMP
 biological_processGO:0071909 determination of stomach left/right asymmetry IMP
 biological_processGO:0071910 determination of liver left/right asymmetry IMP
 biological_processGO:0072189 ureter development IMP
 biological_processGO:0090090 negative regulation of canonical Wnt signaling pathway IDA
 biological_processGO:2000095 regulation of Wnt signaling pathway, planar cell polarity pathway ISS
 biological_processGO:2000167 regulation of planar cell polarity pathway involved in neural tube closure IC
 cellular_componentGO:0005829 cytosol TAS
 cellular_componentGO:0005929 cilium TAS
 molecular_functionGO:0005515 protein binding IPI


Pathways (from Reactome)
Pathway description
No match


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr