ENSDARG00000100166


Danio rerio
domainrepeatcaskinsterilealphamotifankyrincaskin-samephrinreceptorshpointedsuperfamilyrepeat-containingc-terminalcask-interactionregulationsignalingpathwaybinding

Features
Gene ID: ENSDARG00000100166
  
Biological name :si:dkeyp-9d4.3
  
Synonyms : si:dkeyp-9d4.3
  
Possible biological names infered from orthology : CASKIN1 / CASK interacting protein 1 / Q6P9K8 / Q8WXD9
  
Species: Danio rerio
  
Chr. number: 1
Strand: -1
Band:
Gene start: 8022320
Gene end: 8101495
  
Corresponding Affymetrix probe sets:
  
Cross references: Ensembl peptide - ENSDARP00000134723
NCBI entrez gene - 100148061     See in Manteia.
RefSeq - XM_009306160
swissprot - A0A0R4IGS7
ZFIN ID - ZDB-GENE-110914-175
Ensembl - ENSDARG00000100166
  
See expression report in BioGPS
See gene description in Wikigenes
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 ENSGALG00000030169Gallus gallus
 ENSGALG00000005844Gallus gallus
 Q8WXD9ENSG00000167971Homo sapiens
 Q6P9K8ENSMUSG00000033597Mus musculus


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
caskin1 / CASK interacting protein 1 / Q8WXD9*ENSDARG0000004610745
si:ch211-119c20.2 / Q8VHK1* / Q8WXE0* / CASKIN2* / CASK interacting protein 2*ENSDARG0000004381832
A5PMU4 / anks1b / ankyrin repeat and sterile alpha motif domain containing 1B / Q7Z6G8* / ankyrin repeat and sterile alpha motif domain-containing protein 1B isoform 6 *ENSDARG0000000351215
ankrd6b / ankyrin repeat domain 6b / Q9Y2G4* / Q69ZU8* / ANKRD6* / ankyrin repeat domain 6* / Mus musculus ankyrin repeat domain 6 (Ankrd6), transcript variant 4, mRNA.*ENSDARG000000293708
ankdd1a / ankyrin repeat and death domain containing 1A / Q495B1*ENSDARG000000986478
ankdd1b / ankyrin repeat and death domain containing 1B / A6NHY2* / Q14DN9* / Ankyrin repeat and death domain-containing protein 1B *ENSDARG000000258667
mib1 / Q804S5 / mindbomb E3 ubiquitin protein ligase 1 / Q80SY4* / Q86YT6* / E3 ubiquitin-protein ligase MIB1 *ENSDARG000001021847
MIB2 / mindbomb E3 ubiquitin protein ligase 2 / Q96AX9*ENSDARG000001036096
ankrd6a / ankyrin repeat domain 6a / Q9Y2G4* / Q69ZU8* / ANKRD6* / ankyrin repeat domain 6* / Mus musculus ankyrin repeat domain 6 (Ankrd6), transcript variant 4, mRNA.*ENSDARG000000577905
anks1ab / ankyrin repeat and sterile alpha motif domain containing 1Ab / Anks1* / Q92625* / ANKS1A* / P59672* / Ankyrin repeat and SAM domain-containing protein 1A * / ankyrin repeat and st...ENSDARG000000789015
anks1aa / ankyrin repeat and sterile alpha motif domain containing 1Aa / Anks1* / Q92625* / ANKS1A* / P59672* / Ankyrin repeat and SAM domain-containing protein 1A * / ankyrin repeat and st...ENSDARG000000623963


Protein motifs (from Interpro)
Interpro ID Name
 IPR001452  SH3 domain
 IPR001660  Sterile alpha motif domain
 IPR002110  Ankyrin repeat
 IPR013761  Sterile alpha motif/pointed domain superfamily
 IPR020683  Ankyrin repeat-containing domain
 IPR027013  Caskin-1
 IPR032117  Caskin, C-terminal
 IPR032232  Caskin-1, CASK-interaction domain
 IPR035497  Caskin1/2, SAM repeat 1
 IPR035498  Caskin1/2, SAM repeat 2


Gene Ontology (GO)
cell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcellular response to stimuluscell communicationcell communicationcellular response to stimuluscellular response to stimulus
protein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein bindingprotein binding
TypeGO IDTermEv.Code
 biological_processGO:1901187 regulation of ephrin receptor signaling pathway IEA
 molecular_functionGO:0046875 ephrin receptor binding IEA


Pathways (from Reactome)
Pathway description
No match


Phenotype (from MGI, Zfin or HPO)
IDPhenotypeDefinition Genetic BG
No match
  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr