ENSG00000089682


Homo sapiens
bindingRBM41rnadomainurecognitionmotifrna-bindingsuperfamilymrnasplicingviaspliceosomedevelopmentalprocess-typespliceosomalcomplexnucleicacidproteinsnrnapre-mrnaintronic

Features
Gene ID: ENSG00000089682
  
Biological name :RBM41
  
Synonyms : Q96IZ5 / RBM41 / RNA binding motif protein 41
  
Possible biological names infered from orthology :
  
Species: Homo sapiens
  
Chr. number: X
Strand: -1
Band: q22.3
Gene start: 107064420
Gene end: 107118823
  
Corresponding Affymetrix probe sets: 219754_at (Human Genome U133 Plus 2.0 Array)   232860_x_at (Human Genome U133 Plus 2.0 Array)   
  
Cross references: Ensembl peptide - ENSP00000361557
Ensembl peptide - ENSP00000361565
Ensembl peptide - ENSP00000405522
Ensembl peptide - ENSP00000433251
NCBI entrez gene - 55285     See in Manteia.
RefSeq - NM_018301
RefSeq - XM_011530981
RefSeq - NM_001171080
RefSeq - NM_001324242
RefSeq - NM_001324243
RefSeq - NM_001324244
RefSeq - XM_011530980
RefSeq Peptide - NP_060771
RefSeq Peptide - NP_001311172
RefSeq Peptide - NP_001311173
RefSeq Peptide - NP_001311171
RefSeq Peptide - NP_001164551
swissprot - H0Y6F9
swissprot - Q96IZ5
Ensembl - ENSG00000089682
  
See expression report in BioGPS
See gene description in Wikigenes
See gene description in GeneCards
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 rbm41ENSDARG00000054096Danio rerio
 RBM41ENSGALG00000004832Gallus gallus
 Rbm41ENSMUSG00000031433Mus musculus


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
RNPC3 / Q96LT9 / RNA binding region (RNP1, RRM) containing 3ENSG0000018594622


Protein motifs (from Interpro)
Interpro ID Name
 IPR000504  RNA recognition motif domain
 IPR035979  RNA-binding domain superfamily


Gene Ontology (GO)
nitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processcellular metabolic processprimary metabolic processorganic substance metabolic processnitrogen compound metabolic processnitrogen compound metabolic processcellular metabolic processcellular metabolic processprimary metabolic processprimary metabolic processorganic substance metabolic processorganic substance metabolic process
organic cyclic compound bindingheterocyclic compound bindingprotein bindingorganic cyclic compound bindingheterocyclic compound bindingprotein bindingorganic cyclic compound bindingheterocyclic compound bindingprotein bindingorganic cyclic compound bindingheterocyclic compound bindingprotein bindingorganic cyclic compound bindingheterocyclic compound bindingprotein bindingorganic cyclic compound bindingheterocyclic compound bindingprotein bindingorganic cyclic compound bindingheterocyclic compound bindingprotein bindingorganic cyclic compound bindingheterocyclic compound bindingprotein bindingorganic cyclic compound bindingheterocyclic compound bindingprotein bindingorganic cyclic compound bindingheterocyclic compound bindingprotein bindingorganic cyclic compound bindingorganic cyclic compound bindingheterocyclic compound bindingheterocyclic compound bindingprotein bindingprotein binding
cellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellprotein-containing complexorganellecellcellprotein-containing complexprotein-containing complexorganelleorganelle
TypeGO IDTermEv.Code
 biological_processGO:0000398 mRNA splicing, via spliceosome IBA
 biological_processGO:0032502 developmental process IBA
 cellular_componentGO:0005689 U12-type spliceosomal complex IBA
 molecular_functionGO:0003676 nucleic acid binding IEA
 molecular_functionGO:0003723 RNA binding IEA
 molecular_functionGO:0005515 protein binding IPI
 molecular_functionGO:0030626 U12 snRNA binding IBA
 molecular_functionGO:0097157 pre-mRNA intronic binding IBA


Pathways (from Reactome)
Pathway description
No match


Phenotype (from MGI, Zfin or HPO)
IDPhenotypeDefinition Genetic BG
No match
  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr