ENSGALG00000001698


Gallus gallus
receptorGABRA1activityionmembranechannelchlorideion-channeltransmembranetransportalphapostsynapticgamma-aminobutyric-acidsubunitgamma-aminobutyricaciddomainsignalingregulationpotentialcomplexgaba-aglycineligand-bindingconservedsitepathwayplasmaintegralcomponent

Features
Gene ID: ENSGALG00000001698
  
Biological name :GABRA1
  
Synonyms : GABRA1 / Gamma-aminobutyric acid receptor subunit alpha-1 / P19150
  
Possible biological names infered from orthology : gamma-aminobutyric acid type A receptor alpha1 subunit / Mus musculus gamma-aminobutyric acid (GABA) A receptor, subunit alpha 1 (Gabra1), transcript variant 2, mRNA. / P14867 / P62812
  
Species: Gallus gallus
  
Chr. number: 13
Strand: -1
Band:
Gene start: 7191328
Gene end: 7233372
  
Corresponding Affymetrix probe sets: Gga.17167.1.S1_at (Chicken Array)   Gga.19174.1.S1_at (Chicken Array)   
  
Cross references: Ensembl peptide - ENSGALP00000002606
NCBI entrez gene - 374214     See in Manteia.
RefSeq - NM_204318
RefSeq - XM_015293637
RefSeq Peptide - NP_989649
swissprot - P19150
Ensembl - ENSGALG00000001698
  
See expression report in BioGPS
See gene description in Wikigenes
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 gabra1ENSDARG00000068989Danio rerio
 GABRA1ENSG00000022355Homo sapiens
 Gabra1ENSMUSG00000010803Mus musculus


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
GABRA2 / gamma-aminobutyric acid type A receptor alpha2 subunit / P26048* / P47869* / Gamma-aminobutyric acid receptor subunit alpha-2 *ENSGALG0000001420677
GABRA3 / gamma-aminobutyric acid type A receptor alpha3 subunit / P26049* / P34903* / Mus musculus gamma-aminobutyric acid (GABA) A receptor, subunit alpha 3 (Gabra3), transcript variant 3, mRNA.*ENSGALG0000000726972
GABRA5 / gamma-aminobutyric acid type A receptor alpha5 subunit / P31644* / Q8BHJ7* / Gamma-aminobutyric acid receptor subunit alpha-5 *ENSGALG0000001674470
GABRA4 / gamma-aminobutyric acid type A receptor alpha4 subunit / P48169* / Q9D6F4* / Gamma-aminobutyric acid receptor subunit alpha-4 *ENSGALG0000001420258
Q90845 / GABRA6 / Gamma-aminobutyric acid receptor subunit alpha-6 / P16305* / Q16445* / gamma-aminobutyric acid type A receptor alpha6 subunit*ENSGALG0000000169556
GABRG1 / gamma-aminobutyric acid type A receptor gamma1 subunit / Q8N1C3* / Q9R0Y8* / Gamma-aminobutyric acid receptor subunit gamma-1 *ENSGALG0000002014344
GABRG2 / P21548 / Gamma-aminobutyric acid receptor subunit gamma-2 / P22723* / P18507* / gamma-aminobutyric acid type A receptor gamma2 subunit*ENSGALG0000003804243
GABRE / P34904 / Gamma-aminobutyric acid receptor subunit gamma-4 ENSGALG0000002029240
GABRG3* / P27681* / Q99928* / Gamma-aminobutyric acid receptor subunit gamma-3 * / gamma-aminobutyric acid type A receptor gamma3 subunit*ENSGALG0000004104222
GABRG3* / P27681* / Q99928* / Gamma-aminobutyric acid receptor subunit gamma-3 * / gamma-aminobutyric acid type A receptor gamma3 subunit*ENSGALG0000003929318
ENSGALG000000142008


Protein motifs (from Interpro)
Interpro ID Name
 IPR001390  Gamma-aminobutyric-acid A receptor, alpha subunit
 IPR005431  Gamma-aminobutyric-acid A receptor, alpha 1 subunit
 IPR006028  Gamma-aminobutyric acid A receptor/Glycine receptor alpha
 IPR006029  Neurotransmitter-gated ion-channel transmembrane domain
 IPR006201  Neurotransmitter-gated ion-channel
 IPR006202  Neurotransmitter-gated ion-channel ligand-binding domain
 IPR018000  Neurotransmitter-gated ion-channel, conserved site


Gene Ontology (GO)
establishment of localizationcell communicationcellular response to stimulusregulation of biological qualityestablishment of localizationcell communicationcellular response to stimulusregulation of biological qualityestablishment of localizationcell communicationcellular response to stimulusregulation of biological qualityestablishment of localizationcell communicationcellular response to stimulusregulation of biological qualityestablishment of localizationcell communicationcellular response to stimulusregulation of biological qualityestablishment of localizationcell communicationcellular response to stimulusregulation of biological qualityestablishment of localizationcell communicationcellular response to stimulusregulation of biological qualityestablishment of localizationcell communicationcellular response to stimulusregulation of biological qualityestablishment of localizationcell communicationcellular response to stimulusregulation of biological qualityestablishment of localizationcell communicationcellular response to stimulusregulation of biological qualityestablishment of localizationestablishment of localizationcell communicationcell communicationcellular response to stimuluscellular response to stimulusregulation of biological qualityregulation of biological quality
signaling receptor activitytransmembrane transporter activitysignaling receptor activitytransmembrane transporter activitysignaling receptor activitytransmembrane transporter activitysignaling receptor activitytransmembrane transporter activitysignaling receptor activitytransmembrane transporter activitysignaling receptor activitytransmembrane transporter activitysignaling receptor activitytransmembrane transporter activitysignaling receptor activitytransmembrane transporter activitysignaling receptor activitytransmembrane transporter activitysignaling receptor activitytransmembrane transporter activitysignaling receptor activitysignaling receptor activitytransmembrane transporter activitytransmembrane transporter activity
cellmembranecell junctionprotein-containing complexsynapsecellmembranecell junctionprotein-containing complexsynapsecellmembranecell junctionprotein-containing complexsynapsecellmembranecell junctionprotein-containing complexsynapsecellmembranecell junctionprotein-containing complexsynapsecellmembranecell junctionprotein-containing complexsynapsecellmembranecell junctionprotein-containing complexsynapsecellmembranecell junctionprotein-containing complexsynapsecellmembranecell junctionprotein-containing complexsynapsecellmembranecell junctionprotein-containing complexsynapsecellcellmembranemembranecell junctioncell junctionprotein-containing complexprotein-containing complexsynapsesynapse
TypeGO IDTermEv.Code
 biological_processGO:0006811 ion transport IEA
 biological_processGO:0006821 chloride transport IEA
 biological_processGO:0007214 gamma-aminobutyric acid signaling pathway IEA
 biological_processGO:0034220 ion transmembrane transport IEA
 biological_processGO:0060078 regulation of postsynaptic membrane potential IEA
 biological_processGO:1902476 chloride transmembrane transport IEA
 cellular_componentGO:0005886 plasma membrane IEA
 cellular_componentGO:0016020 membrane IEA
 cellular_componentGO:0016021 integral component of membrane IEA
 cellular_componentGO:0030054 cell junction IEA
 cellular_componentGO:0034707 chloride channel complex IEA
 cellular_componentGO:0045202 synapse IEA
 cellular_componentGO:0045211 postsynaptic membrane IEA
 cellular_componentGO:1902711 GABA-A receptor complex IEA
 molecular_functionGO:0004888 transmembrane signaling receptor activity IEA
 molecular_functionGO:0004890 GABA-A receptor activity IBA
 molecular_functionGO:0005216 ion channel activity IEA
 molecular_functionGO:0005230 extracellular ligand-gated ion channel activity IEA
 molecular_functionGO:0005254 chloride channel activity IEA
 molecular_functionGO:0022851 GABA-gated chloride ion channel activity IEA
 molecular_functionGO:1904315 transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential IEA


Pathways (from Reactome)
Pathway description
GABA A receptor activation


Phenotype (from MGI, Zfin or HPO)
IDPhenotypeDefinition Genetic BG
No match
  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
No match






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr