ENSG00000168310


Homo sapiens
IRF2interferonregulatoryrnapolymeraseiibindingfactordnadna-bindingsignalingdomainregulationregionsequence-specificactivitywingedsuperfamilydna-templatedpathwayfactor-conservedsitehelix-likehelixbloodcoagulationcellproliferationdefense

Features
Gene ID: ENSG00000168310
  
Biological name :IRF2
  
Synonyms : interferon regulatory factor 2 / IRF2 / P14316
  
Possible biological names infered from orthology :
  
Species: Homo sapiens
  
Chr. number: 4
Strand: -1
Band: q35.1
Gene start: 184387713
Gene end: 184474580
  
Corresponding Affymetrix probe sets: 203275_at (Human Genome U133 Plus 2.0 Array)   
  
Cross references: Ensembl peptide - ENSP00000422860
Ensembl peptide - ENSP00000423074
Ensembl peptide - ENSP00000427204
Ensembl peptide - ENSP00000425037
Ensembl peptide - ENSP00000424552
Ensembl peptide - ENSP00000377218
Ensembl peptide - ENSP00000421927
NCBI entrez gene - 3660     See in Manteia.
OMIM - 147576
RefSeq - NM_002199
RefSeq Peptide - NP_002190
swissprot - D6R9N5
swissprot - H0Y956
swissprot - K4DIA4
swissprot - K4DIA5
swissprot - D6RED1
swissprot - P14316
swissprot - D6RB08
Ensembl - ENSG00000168310
  

This gene has been taged as a transcription factor by TFT
See expression report in BioGPS
See gene description in Wikigenes
See gene description in GeneCards
See co-cited genes in PubMed


Ortholog prediction (from Ensembl)
Ortholog nameID Species
 irf2ENSDARG00000040465Danio rerio
 IRF2ENSGALG00000010642Gallus gallus
 Irf2ENSMUSG00000031627Mus musculus


Paralog prediction (from Ensembl)
Paralog nameIDSimilarity(%)
IRF1 / P10914 / interferon regulatory factor 1ENSG0000012534737
IRF5 / Q13568 / interferon regulatory factor 5ENSG0000012860426
IRF6 / O14896 / interferon regulatory factor 6ENSG0000011759522
IRF4 / Q15306 / interferon regulatory factor 4ENSG0000013726521
IRF8 / Q02556 / interferon regulatory factor 8ENSG0000014096821
IRF3 / Q14653 / interferon regulatory factor 3ENSG0000012645615
IRF7 / Q92985 / interferon regulatory factor 7ENSG0000018550715
IRF9 / Q00978 / interferon regulatory factor 9ENSG0000021392815


Protein motifs (from Interpro)
Interpro ID Name
 IPR001346  Interferon regulatory factor DNA-binding domain
 IPR017431  Interferon regulatory factor-1/2
 IPR019817  Interferon regulatory factor, conserved site
 IPR031218  Interferon regulatory factor 2
 IPR036388  Winged helix-like DNA-binding domain superfamily
 IPR036390  Winged helix DNA-binding domain superfamily


Gene Ontology (GO)
nitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processresponse to stressregulation of biological qualitycoagulationresponse to external stimulusresponse to biotic stimulusimmune effector processimmune responsecell communicationresponse to chemicalcellular response to stimulusnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processresponse to stressregulation of biological qualitycoagulationresponse to external stimulusresponse to biotic stimulusimmune effector processimmune responsecell communicationresponse to chemicalcellular response to stimulusnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processresponse to stressregulation of biological qualitycoagulationresponse to external stimulusresponse to biotic stimulusimmune effector processimmune responsecell communicationresponse to chemicalcellular response to stimulusnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processresponse to stressregulation of biological qualitycoagulationresponse to external stimulusresponse to biotic stimulusimmune effector processimmune responsecell communicationresponse to chemicalcellular response to stimulusnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processresponse to stressregulation of biological qualitycoagulationresponse to external stimulusresponse to biotic stimulusimmune effector processimmune responsecell communicationresponse to chemicalcellular response to stimulusnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processresponse to stressregulation of biological qualitycoagulationresponse to external stimulusresponse to biotic stimulusimmune effector processimmune responsecell communicationresponse to chemicalcellular response to stimulusnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processresponse to stressregulation of biological qualitycoagulationresponse to external stimulusresponse to biotic stimulusimmune effector processimmune responsecell communicationresponse to chemicalcellular response to stimulusnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processresponse to stressregulation of biological qualitycoagulationresponse to external stimulusresponse to biotic stimulusimmune effector processimmune responsecell communicationresponse to chemicalcellular response to stimulusnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processresponse to stressregulation of biological qualitycoagulationresponse to external stimulusresponse to biotic stimulusimmune effector processimmune responsecell communicationresponse to chemicalcellular response to stimulusnitrogen compound metabolic processbiosynthetic processcellular metabolic processprimary metabolic processorganic substance metabolic processresponse to stressregulation of biological qualitycoagulationresponse to external stimulusresponse to biotic stimulusimmune effector processimmune responsecell communicationresponse to chemicalcellular response to stimulusnitrogen nitrogen compound metabolic processbiosynthebiosynthetic processcellular cellular metabolic processprimary mprimary metabolic processorganic sorganic substance metabolic processresponse response to stressregulatioregulation of biological qualitycoagulaticoagulationresponse response to external stimulusresponse response to biotic stimulusimmune efimmune effector processimmune reimmune responsecell commcell communicationresponse response to chemicalcellular cellular response to stimulus
organic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingorganic cyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor activityprotein bindingorganic cyclic compound bindingorganic cyclic compound bindingheterocyclic compound bindingheterocyclic compound bindingDNA-binding transcription factor acDNA-binding transcription factor activityprotein bindingprotein binding
cellorganellemembrane-enclosed lumencell junctioncellorganellemembrane-enclosed lumencell junctioncellorganellemembrane-enclosed lumencell junctioncellorganellemembrane-enclosed lumencell junctioncellorganellemembrane-enclosed lumencell junctioncellorganellemembrane-enclosed lumencell junctioncellorganellemembrane-enclosed lumencell junctioncellorganellemembrane-enclosed lumencell junctioncellorganellemembrane-enclosed lumencell junctioncellorganellemembrane-enclosed lumencell junctioncellcellorganelleorganellemembrane-enclosed lumenmembrane-enclosed lumencell junctioncell junction
TypeGO IDTermEv.Code
 biological_processGO:0000122 negative regulation of transcription by RNA polymerase II TAS
 biological_processGO:0006351 transcription, DNA-templated IEA
 biological_processGO:0006355 regulation of transcription, DNA-templated IEA
 biological_processGO:0006366 transcription by RNA polymerase II IEA
 biological_processGO:0007596 blood coagulation TAS
 biological_processGO:0008283 cell proliferation IEA
 biological_processGO:0045944 positive regulation of transcription by RNA polymerase II IMP
 biological_processGO:0051607 defense response to virus IDA
 biological_processGO:0060333 interferon-gamma-mediated signaling pathway TAS
 biological_processGO:0060337 type I interferon signaling pathway TAS
 cellular_componentGO:0005634 nucleus IEA
 cellular_componentGO:0005654 nucleoplasm IDA
 cellular_componentGO:0005829 cytosol TAS
 cellular_componentGO:0005925 focal adhesion IDA
 molecular_functionGO:0000977 RNA polymerase II regulatory region sequence-specific DNA binding IMP
 molecular_functionGO:0000981 RNA polymerase II transcription factor activity, sequence-specific DNA binding NAS
 molecular_functionGO:0001228 transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific DNA binding IMP
 molecular_functionGO:0003677 DNA binding IEA
 molecular_functionGO:0003700 DNA-binding transcription factor activity IEA
 molecular_functionGO:0005515 protein binding IPI
 molecular_functionGO:0044212 transcription regulatory region DNA binding IEA


Pathways (from Reactome)
Pathway description
Interferon gamma signaling
Interferon alpha/beta signaling
Factors involved in megakaryocyte development and platelet production


Phenotype (from MGI, Zfin or HPO)
IDPhenotypeDefinition Genetic BG
No match
  


Interacting proteins (from Reactome)
Interactor ID Name Interaction type
 ENSG00000168310 IRF2 / P14316 / interferon regulatory factor 2  / reaction






 

0 s.

 
External programs and data are copyrighted by and are the property of their respective authors.
The Manteia system, data and analyses are provided "as is" with no warranties, expressed or implied as to capabilities or accuracy. User assumes the entire risk as to the results and performance of the software, data and documentation


                   


© Olivier Tassy / Olivier Pourquie 2007-2025
contact: otassy@igbmc.fr